DLX3 Antibody - BSA Free Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of human DLX3. Peptide sequence: SASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
DLX3 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
1 mg/ml |
Purity |
Protein A purified |
Alternate Names for DLX3 Antibody - BSA Free
Background
Dlx genes are a highly conserved family of six different (Dlx1
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ChIP, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: BA
Species: Hu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: BA, BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
Species: Hu
Applications: ChIP, IHC, IHC-P, WB
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Publications for DLX3 Antibody (NBP2-88803) (0)
There are no publications for DLX3 Antibody (NBP2-88803).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DLX3 Antibody (NBP2-88803) (0)
There are no reviews for DLX3 Antibody (NBP2-88803).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DLX3 Antibody (NBP2-88803) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DLX3 Products
Research Areas for DLX3 Antibody (NBP2-88803)
Find related products by research area.
|
Blogs on DLX3