Recombinant Human Enamelin Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Enamelin Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acids 1043-1141 of Human ENAM partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ERQQQRPSNILHLPCFGSKLAKHHSSTTGTPSSDGRQSPFDGDSITPTENPNTLVELATEEQFKSINVDPLDADEHSPFEFLQRGTNVQDQVQDCLLLQ

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ENAM
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Publications
Read Publication using H00010117-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Enamelin Protein

  • ADAI
  • AI1C
  • AIH2
  • amelogenesis imperfecta 2, hypocalcification (autosomal dominant)
  • ENAM
  • Enamelin

Background

ENAM - enamelin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87446
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1142
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-22683
Species: Hu
NBP1-62322
Species: Hu
Applications: WB
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-91612
Species: Mu
Applications: WB
NBP2-46517
Species: Hu
Applications: WB, IHC
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-45525
Species: Hu, Mu, Rt
Applications: WB
NBP2-24646
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
NBP2-34355
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, Flow-IC
H00054959-M02
Species: Hu
Applications: WB, ELISA
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-93737
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Enamelin Partial Recombinant Protein (H00010117-Q01)(1)

Reviews for Enamelin Partial Recombinant Protein (H00010117-Q01) (0)

There are no reviews for Enamelin Partial Recombinant Protein (H00010117-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Enamelin Partial Recombinant Protein (H00010117-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Enamelin Partial Recombinant Protein (H00010117-Q01)

Discover related pathways, diseases and genes to Enamelin Partial Recombinant Protein (H00010117-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Enamelin Partial Recombinant Protein (H00010117-Q01)

Discover more about diseases related to Enamelin Partial Recombinant Protein (H00010117-Q01).
 

Pathways for Enamelin Partial Recombinant Protein (H00010117-Q01)

View related products by pathway.

PTMs for Enamelin Partial Recombinant Protein (H00010117-Q01)

Learn more about PTMs related to Enamelin Partial Recombinant Protein (H00010117-Q01).

Blogs on Enamelin

There are no specific blogs for Enamelin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Enamelin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ENAM