DLX3 Antibody


Western Blot: DLX3 Antibody [NBP2-88802] - WB Suggested Anti-DLX3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Transfected 293T
Immunohistochemistry: DLX3 Antibody [NBP2-88802] - Placenta
Immunohistochemistry: DLX3 Antibody [NBP2-88802] - Paraffin Embedded Tissue: Human Kidney. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X

Product Details

Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, ShSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

DLX3 Antibody Summary

The immunogen is a synthetic peptide directed towards the N-terminal region of human DLX3. Peptide sequence: SSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQT The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Sheep (100%), Equine (100%), Rabbit (100%), Bovine (100%), Guinea Pig (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for DLX3 Antibody

  • AI4
  • distal-less homeo box 3
  • distal-less homeobox 3
  • homeobox protein DLX-3
  • TDO


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
Species: Hu, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, Sh
Applications: WB, IHC, IHC-P

Publications for DLX3 Antibody (NBP2-88802) (0)

There are no publications for DLX3 Antibody (NBP2-88802).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DLX3 Antibody (NBP2-88802) (0)

There are no reviews for DLX3 Antibody (NBP2-88802). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DLX3 Antibody (NBP2-88802) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional DLX3 Products

Bioinformatics Tool for DLX3 Antibody (NBP2-88802)

Discover related pathways, diseases and genes to DLX3 Antibody (NBP2-88802). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DLX3 Antibody (NBP2-88802)

Discover more about diseases related to DLX3 Antibody (NBP2-88802).

Pathways for DLX3 Antibody (NBP2-88802)

View related products by pathway.

PTMs for DLX3 Antibody (NBP2-88802)

Learn more about PTMs related to DLX3 Antibody (NBP2-88802).

Research Areas for DLX3 Antibody (NBP2-88802)

Find related products by research area.

Blogs on DLX3

There are no specific blogs for DLX3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DLX3 Antibody and receive a gift card or discount.


Gene Symbol DLX3