Reactivity | Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, ShSpecies Glossary |
Applications | WB, IHC, IHC-P |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human DLX3. Peptide sequence: SSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQT The peptide sequence for this immunogen was taken from within the described region. |
Predicted Species | Mouse (100%), Rat (100%), Canine (100%), Sheep (100%), Equine (100%), Rabbit (100%), Bovine (100%), Guinea Pig (100%). Backed by our 100% Guarantee. |
Clonality | Polyclonal |
Host | Rabbit |
Gene | DLX3 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS, 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for DLX3 Antibody (NBP2-88802)Discover more about diseases related to DLX3 Antibody (NBP2-88802).
| Pathways for DLX3 Antibody (NBP2-88802)View related products by pathway.
|
PTMs for DLX3 Antibody (NBP2-88802)Learn more about PTMs related to DLX3 Antibody (NBP2-88802).
| Research Areas for DLX3 Antibody (NBP2-88802)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | DLX3 |