Dkk-2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Dkk-2 Antibody [NBP2-68703] - Staining of human cell line SH-SY5Y shows localization to cytosol & the Golgi apparatus. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Dkk-2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Dkk-2 Antibody - BSA Free (NBP2-68703) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-Dkk-2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCC
• Predicted Species: Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DKK2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry Reported in scientific literature (PMID:34282126)
• Application Notes: ICC/IF Fixation/Permeabilization: PFA/Triton X-100

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:34282126).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for Dkk-2 Antibody - BSA Free

• dickkopf (Xenopus laevis) homolog 2
• dickkopf 2
• dickkopf homolog 2 (Xenopus laevis)
• dickkopf related protein-2
• dickkopf-2
• dickkopf-related protein 2
• Dkk2
• Dkk-2
• hDkk-2

Background

Analysis of individual DKK domains and chimeric DKKs shows that the carboxy-terminal domains of both DKK1 and DKK2 associate with LRP6 and are necessary and sufficient for Wnt8 inhibition. Xenopus Dickkopf 1 (DKK1) was initially discovered as a Wnt antagonist that plays an important role in head formation. By far, four members of DKK have been identified in mammals. Each DKK molecule contains two conserved cysteine-rich domains. Recent studies showed that the second Cys-rich domains of DKK1 and DKK2 inhibited Wnt3a-activated signaling, whereas the first Cys-rich domains had no effects. In addition, the second Cys-rich domain of DKK2, but not that of DKK1, was able to activate the canonical pathway in the presence of LRP6, and this LRP-dependent signaling does not require Dvl.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Dkk-2 Antibody (NBP2-68703)(1)

Publication using NBP2-68703

• Li F, Yan K, Wu L Et Al. Single-cell RNA-seq reveals cellular heterogeneity of mouse carotid artery under disturbed flow Cell death discovery 2021-07-16 [PMID: 34282126] (IF/IHC)

Bioinformatics

• Gene Symbol: DKK2