DIP2A Antibody


Immunocytochemistry/ Immunofluorescence: DIP2A Antibody [NBP2-30966] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus.
Immunohistochemistry-Paraffin: DIP2A Antibody [NBP2-30966] - Staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

DIP2A Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: RAKLLARYIPLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRS
Specificity of human DIP2A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DIP2A Protein (NBP2-30966PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DIP2A Antibody

  • C21orf106
  • DIP2 disco-interacting protein 2 homolog A (Drosophila)
  • DIP2 Homolog A
  • Dip2
  • DIP2A
  • DIP2C21orf106
  • disco-interacting protein 2 homolog A
  • disco-interacting protein 2A
  • KIAA0184chromosome 21 open reading frame 106


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Rt
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for DIP2A Antibody (NBP2-30966) (0)

There are no publications for DIP2A Antibody (NBP2-30966).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DIP2A Antibody (NBP2-30966) (0)

There are no reviews for DIP2A Antibody (NBP2-30966). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DIP2A Antibody (NBP2-30966) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DIP2A Products

Bioinformatics Tool for DIP2A Antibody (NBP2-30966)

Discover related pathways, diseases and genes to DIP2A Antibody (NBP2-30966). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DIP2A Antibody (NBP2-30966)

Discover more about diseases related to DIP2A Antibody (NBP2-30966).

Pathways for DIP2A Antibody (NBP2-30966)

View related products by pathway.

PTMs for DIP2A Antibody (NBP2-30966)

Learn more about PTMs related to DIP2A Antibody (NBP2-30966).

Blogs on DIP2A

There are no specific blogs for DIP2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DIP2A Antibody and receive a gift card or discount.


Gene Symbol DIP2A