DIP2A Antibody

Western Blot: DIP2A Antibody [NBP1-56909] - HT1080 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

DIP2A Antibody Summary

• Immunogen: Synthetic peptides corresponding to DIP2A(DIP2 disco-interacting protein 2 homolog A (Drosophila)) The peptide sequence was selected from the N terminal of DIP2A. Peptide sequence PLKEFFVDDFEELLEVQQPDPNQPKPEGSETSVLRGEPLTAGVPRPPSLL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DIP2A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against DIP2A and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DIP2A Antibody

• C21orf106
• DIP2 disco-interacting protein 2 homolog A (Drosophila)
• DIP2 Homolog A
• Dip2
• DIP2A
• DIP2C21orf106
• disco-interacting protein 2 homolog A
• disco-interacting protein 2A
• KIAA0184chromosome 21 open reading frame 106

Background

The protein encoded by this gene may be involved in axon patterning in the central nervous system. This gene is not highly expressed. Several transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DIP2A
• Uniprot:
  • Q14689(Human)