DIO3 Recombinant Protein Antigen

Images

 
There are currently no images for DIO3 Recombinant Protein Antigen (NBP3-17201PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DIO3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DIO3

Source: E. coli

Amino Acid Sequence: IRKHFLGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DIO3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17201.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DIO3 Recombinant Protein Antigen

  • 5DIII
  • D3
  • deiodinase, iodothyronine, type III
  • DIOIII
  • EC 1.97.1
  • EC 1.97.1.11
  • ITDI3
  • placental type
  • thyroxine deiodinase type III (selenoprotein)
  • Type 3 DI
  • type 3 iodothyronine selenodeiodinase
  • type III iodothyronine deiodinase
  • type-III 5' deiodinase
  • Type-III 5'-deiodinase

Background

Iodothyronine deiodinase 3 (DIO3) is a peroxidase enzyme that is involved in the activation or deactivation of thyroid hormones. Specifically, DIO-3 deiodinizes the thyroid hormones T4 and T3 into their respective inactive metabolites, RT3 and T2.

Dio3 has an essential role for regulation of thyroid hormone inactivation during embryological development, and may play a role in preventing premature exposure of developing fetal tissues to adult levels of thyroid hormones. Dio3 has been linked to the development of consumptive hypothyroidism in both infants and adults.

DIO3 antibodies are useful tools for hormone regulation research and in some embryological development studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-00178
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89396
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56725
Species: Hu, Mu
Applications: Flow-IC, Flow, IHC,  IHC-P, IP, WB
NBP3-12391
Species: Hu, Mu, Rt
Applications: DB, ELISA, ICC/IF, IP, WB
MAB7665
Species: Hu
Applications: IHC, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-31308
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB6570
Species: Hu
Applications: IHC, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-13225
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NLS3921
Species: Hu, Pm, Pm
Applications: IHC,  IHC-P
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-86713
Species: Hu
Applications: IHC,  IHC-P
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP3-25443
Species: Hu, Mu, Rt
Applications: Func, ICC/IF, IHC,  IHC-P, WB
NBP3-17201PEP
Species: Hu
Applications: AC

Publications for DIO3 Recombinant Protein Antigen (NBP3-17201PEP) (0)

There are no publications for DIO3 Recombinant Protein Antigen (NBP3-17201PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DIO3 Recombinant Protein Antigen (NBP3-17201PEP) (0)

There are no reviews for DIO3 Recombinant Protein Antigen (NBP3-17201PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DIO3 Recombinant Protein Antigen (NBP3-17201PEP). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for a Dio3 peptide that I can inject in vivo to produce a biological effect. Can you provide information or confirm whether the Dio3 peptide you have would be effective as a biological agent in vivo?
    • I have pulled up information on the Dio3 peptides and recombinant proteins that we have available. Unfortunately I would not expect any of them to be biologically active and capable of producing a response when injected in vivo. The two peptides we carry are simply intended to be used for negative control competition assays to block signal of the primary and determine what is specific and non-specific as far as signal is concerned. The other two recombinant proteins are ones we distribute for a Taiwanese company called Abnova and they should not be biologically active based on the cell free wheat germ system employed to synthesize them. We will typically list our active proteins with an indication of such on our datasheet if it has been tested and usually the application of functional listed.

Additional DIO3 Products

Array NBP3-17201PEP

Research Areas for DIO3 Recombinant Protein Antigen (NBP3-17201PEP)

Find related products by research area.

Blogs on DIO3

There are no specific blogs for DIO3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DIO3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DIO3