Recombinant Human DIO3 GST (N-Term) Protein

SDS-Page: Recombinant Human DIO3 Protein [H00001735-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, PA, PAGE, AP

Recombinant Human DIO3 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 43-143 of Human DIO3
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: KHFLGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVVLPDGFQSQHILDYAQGNRPLVLNFGSCT

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: DIO3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 36.85 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DIO3 GST (N-Term) Protein

• 5DIII
• D3
• deiodinase, iodothyronine, type III
• DIOIII
• EC 1.97.1
• EC 1.97.1.11
• ITDI3
• placental type
• thyroxine deiodinase type III (selenoprotein)
• Type 3 DI
• type 3 iodothyronine selenodeiodinase
• type III iodothyronine deiodinase
• type-III 5' deiodinase
• Type-III 5'-deiodinase

Background

The protein encoded by this intronless gene belongs to the iodothyronine deiodinase family. It catalyzes the inactivation of thyroid hormone by inner ring deiodination of the prohormone thyroxine (T4) and the bioactive hormone 3,3',5-triiodothyronine (T3) to inactive metabolites, 3,3',5'-triiodothyronine (RT3) and 3,3'-diiodothyronine (T2), respectively. This enzyme is highly expressed in the pregnant uterus, placenta, fetal and neonatal tissues, suggesting that it plays an essential role in the regulation of thyroid hormone inactivation during embryological development. This protein contains a selenocysteine (Sec) residue, which is essential for efficient enzyme activity. The selenocysteine is encoded by the UGA codon, which normally signals translation termination. The 3' UTR of Sec-containing genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

FAQs for DIO3 Partial Recombinant Protein (H00001735-Q01). (Showing 1 - 1 of 1 FAQ).

1. I am looking for a Dio3 peptide that I can inject in vivo to produce a biological effect. Can you provide information or confirm whether the Dio3 peptide you have would be effective as a biological agent in vivo?
   • I have pulled up information on the Dio3 peptides and recombinant proteins that we have available. Unfortunately I would not expect any of them to be biologically active and capable of producing a response when injected in vivo. The two peptides we carry are simply intended to be used for negative control competition assays to block signal of the primary and determine what is specific and non-specific as far as signal is concerned. The other two recombinant proteins are ones we distribute for a Taiwanese company called Abnova and they should not be biologically active based on the cell free wheat germ system employed to synthesize them. We will typically list our active proteins with an indication of such on our datasheet if it has been tested and usually the application of functional listed.

Bioinformatics

• Gene Symbol: DIO3