Dicer Antibody (CL0378)

Images

 
Western Blot: Dicer Antibody (CL0378) [NBP2-30699] - Analysis of extracts from RT-4 cells, transfected with either control siRNA (siRNA ctrl) or target specific siRNA probes (siRNA#1, siRNA#2), using Anti-DICER ...read more
Immunocytochemistry/ Immunofluorescence: Dicer Antibody (CL0378) [NBP2-30699] - Staining of A-431 cells using the anti-DICER1 monoclonal antibody, showing specific staining in the cytosol in green. Microtubule- and ...read more
Immunohistochemistry-Paraffin: Dicer Antibody (CL0378) [NBP2-30699] - Staining of human breast cancer (ductal carcinoma) shows moderate cytoplasmic positivity in cancer cells.
Western Blot: Dicer Antibody (CL0378) [NBP2-30699] - Lane 1: Marker [kDa]. Lane 2: Human cell line HEK293T
Immunohistochemistry-Paraffin: Dicer Antibody (CL0378) [NBP2-30699] - Staining of human uterus shows cytoplasmic immunoreactivity in the glandular epithelium cells.
Immunohistochemistry-Paraffin: Dicer Antibody (CL0378) [NBP2-30699] - Staining of human testis shows cytoplasmic positivity in the seminiferous tubules cells.
Immunohistochemistry-Paraffin: Dicer Antibody (CL0378) [NBP2-30699] - Staining of human prostate shows cytoplasmic immunoreactivity in the glandular epithelium cells.
Immunohistochemistry-Paraffin: Dicer Antibody (CL0378) [NBP2-30699] - Staining of human cerebral cortex shows cytoplasmic positivity in the glial cells.
Immunohistochemistry-Paraffin: Dicer Antibody (CL0378) [NBP2-30699] - Staining of human colorectal cancer (adenocarcinoma) shows cytoplasmic positivity in cancer cells.
Immunohistochemistry-Paraffin: Dicer Antibody (CL0378) [NBP2-30699] - Staining of human lung cancer (adenocarcinoma) shows strong cytoplasmic positivity in cancer cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clone
CL0378
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Dicer Antibody (CL0378) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG2a
Clonality
Monoclonal
Host
Mouse
Gene
DICER1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Dicer Antibody (CL0378)

  • DCR1
  • dicer 1, double-stranded RNA-specific endoribonuclease
  • dicer 1, ribonuclease type III
  • Dicer
  • Dicer1, Dcr-1 homolog (Drosophila)
  • EC 3.1.26
  • EC 3.1.26.-
  • EC 3.1.26.3
  • Helicase MOI
  • Helicase with RNase motif
  • helicase-moi
  • HERNADicer1, Dcr-1 homolog
  • K12H4.8-LIKE
  • KIAA0928endoribonuclease Dicer

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-03349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2817
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP2-24725
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NB200-335
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-89605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF6548
Species: Hu, Mu
Applications: IHC
AF6367
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF3757
Species: Hu
Applications: WB, ICC
MAB1980
Species: Hu
Applications: WB, Simple Western, IP, ICC
NBP1-76985
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-89327
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Dicer Antibody (NBP2-30699) (0)

There are no publications for Dicer Antibody (NBP2-30699).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dicer Antibody (NBP2-30699) (0)

There are no reviews for Dicer Antibody (NBP2-30699). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Dicer Antibody (NBP2-30699) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dicer Products

Bioinformatics Tool for Dicer Antibody (NBP2-30699)

Discover related pathways, diseases and genes to Dicer Antibody (NBP2-30699). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dicer Antibody (NBP2-30699)

Discover more about diseases related to Dicer Antibody (NBP2-30699).
 

Pathways for Dicer Antibody (NBP2-30699)

View related products by pathway.

PTMs for Dicer Antibody (NBP2-30699)

Learn more about PTMs related to Dicer Antibody (NBP2-30699).
 

Research Areas for Dicer Antibody (NBP2-30699)

Find related products by research area.

Blogs on Dicer.

Slicing and Dicing RNA with Dicer
Dicer is an RNaseIII-like enzyme capable of cleaving double-stranded RNA (dsRNA) into smaller 21-23 nt RNA fragments known as short interfering RNA (siRNAs). It targets the selective degradation of complementary RNAs in a posttranscriptional gene sile...  Read full blog post.

Ago2 antibodies and dicer-independent biogenesis of miRNA
Ago2, also called eIF2C2, antibody is one of 37 reagents targeted to the Argonaute protein family that we at Novus Biologicals have in our antibody catalogue. Argonaute proteins are encoded by genes which play an important role in regulating the contr...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dicer Antibody (CL0378) and receive a gift card or discount.

Bioinformatics

Gene Symbol DICER1
Uniprot