DHX58 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: GLLTNEISMVQARGRARADQSVYAFVATEGSRELKRELINEALETLMEQAVAAVQKMDQAEYQAKIRDLQQAALTKRAAQAAQRENQRQQFPVEHVQLLCINCMVAV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DHX58 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (80%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for DHX58 Antibody - BSA Free
Background
Negative regulator of host innate immune defense against viruses. The repressor domain of DHX58 interactswith DDX58 and negatively regulates DDX58-mediated signaling. Binds dsRNA produced during viral replication, inparticuliar HCV RNA. Binding occurs at blunt dsRNA termini
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Pm
Applications: Flow, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: BA, DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, Simple Western, WB
Species: Mu, Po, Rt
Applications: IB, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu
Applications: ICC
Species: Bv, Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: All-Multi
Applications: Flow, ICC, IHC, WB
Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze
Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC, IP, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC
Publications for DHX58 Antibody (NBP1-85349) (0)
There are no publications for DHX58 Antibody (NBP1-85349).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DHX58 Antibody (NBP1-85349) (0)
There are no reviews for DHX58 Antibody (NBP1-85349).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for DHX58 Antibody (NBP1-85349) (0)