DHX40 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DHX40 Antibody [NBP1-91834] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: DHX40 Antibody [NBP1-91834] - Staining of human endometrium shows weak to moderate nuclear positivity in a subset of glandular cells.

Immunohistochemistry-Paraffin: DHX40 Antibody [NBP1-91834] - Staining of human testis shows strong nuclear positivity in Leydig cells, as well as moderate positivity in cells in seminiferous tubules.

Immunohistochemistry-Paraffin: DHX40 Antibody [NBP1-91834] - Staining of human fallopian tube shows weak to moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: DHX40 Antibody [NBP1-91834] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DHX40 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SVGRTFCTMDGRGSPVHIHPSSALHEQETKLEWIIFHEVLVTTKVYARIVCPIRYEWVRDLLPKLHEFNAHDLSSVARREVREDARRRWTNKENVKQLKDGISKDVLKKMQRRNDDKSISDARARF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DHX40
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DHX40 Protein (NBP1-91834PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DHX40 Antibody - BSA Free

• ARG147
• DDX40FLJ34015
• DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 40 (RNA helicase)
• DEAH (Asp-Glu-Ala-His) box polypeptide 40
• DEAH box protein 40
• EC 3.6.1
• EC 3.6.4.13
• FLJ22060
• PAD
• probable ATP-dependent RNA helicase DHX40
• Protein PAD

Background

DDX40 is a member of the DExH/D box family of ATP-dependent RNA helicases. RNA helicases catalyze the unwinding of double-stranded RNA and play a role in RNA metabolism, including pre-mRNA splicing, ribosome biogenesis, and organellar gene expression.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DHX40 Antibody (NBP1-91834)(1)

Publication using NBP1-91834

• Carolyn M Jablonowski, Waise Quarni, Shivendra Singh, Haiyan Tan, Dhanushka Hewa Bostanthirige, Hongjian Jin, Jie Fang, Ti-Cheng Chang, David Finkelstein, Ji-Hoon Cho, Dongli Hu, Vishwajeeth Pagala, Sadie Miki Sakurada, Shondra M Pruett-Miller, Ruoning Wang, Andrew Murphy, Kevin Freeman, Junmin Peng, Andrew M Davidoff, Gang Wu, Jun Yang, Sean Lawler, Wafik S El-Deiry Metabolic reprogramming of cancer cells by JMJD6-mediated pre-mRNA splicing associated with therapeutic response to splicing inhibitor eLife 2024-03-15 [PMID: 38488852]

Bioinformatics

• Gene Symbol: DHX40
• Entrez:
  • 79665(Human)
• Uniprot:
  • Q8IX18(Human)