DGK-iota Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DGK-iota Antibody [NBP1-85227] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DGK-iota Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DGK-iota Antibody - BSA Free (NBP1-85227) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IRVNKISLQDYEGFHYDKEKLREASIPLGILVVRGDCDLETCRMYIDRLQEDLQSVSSGSQRVHYQDHET
• Predicted Species: Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DGKI
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DGK-iota Protein (NBP1-85227PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DGK-iota Antibody - BSA Free

• DAG kinase iota
• DGKI
• DGKiota
• DGK-iota
• diacylglycerol kinase iota
• diacylglycerol kinase, iota
• Diglyceride kinase iota
• EC 2.7.1.107

Background

Diacylglycerol (DAG) influences numerous cell signaling cascades by functioning as an intracellular, allosteric activator of protein kinase C (PKC), and as a potent activator of guanine nucleotide exchange factors. In order to maintain cellular homeostasis, intracellular DAG levels are tightly regulated by diacylglycerol kinases (DGKs, DAGKs), which phosphorylate DAG to phosphatidic acid, thus removing DAG. Human DGK-alpha (80 kDa), -beta (90 kDa), and - gamma (90 kDa) have calcium-binding EF-hand motifs at their N termini and are classified as type I DGKs. Human DGK-delta (130 kDa) and DGK-

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DGKI