DGK-iota Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DGK-iota Antibody [NBP1-85227] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DGK-iota Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IRVNKISLQDYEGFHYDKEKLREASIPLGILVVRGDCDLETCRMYIDRLQEDLQSVSSGSQRVHYQDHET
Specificity
Specificity of human DGK-iota antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DGKI
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DGK-iota Protein (NBP1-85227PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DGK-iota Antibody

  • DAG kinase iota
  • DGKI
  • DGKiota
  • DGK-iota
  • diacylglycerol kinase iota
  • diacylglycerol kinase, iota
  • Diglyceride kinase iota
  • EC 2.7.1.107

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6389
Species: Hu, Mu, Rt
Applications: WB
NBP2-47476
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB400-146
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-P
AF1749
Species: Rt
Applications: WB, IHC
MAB5125
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-38184
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-93472
Species: Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-30708
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6727
Species: Hu
Applications: WB
NBP2-45528
Species: Hu
Applications: WB, IHC
NB100-485
Species: Hu
Applications: WB, IP
MAB4099
Species: Hu
Applications: WB, IP
DDX0390P-100
Species: Mu
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo
AF4509
Species: Hu
Applications: WB, ICC
NBP2-46424
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14408
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2864
Species: Hu
Applications: WB, ICC
NBP1-85227
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for DGK-iota Antibody (NBP1-85227) (0)

There are no publications for DGK-iota Antibody (NBP1-85227).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DGK-iota Antibody (NBP1-85227) (0)

There are no reviews for DGK-iota Antibody (NBP1-85227). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DGK-iota Antibody (NBP1-85227) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for DGK-iota Antibody (NBP1-85227)

Discover related pathways, diseases and genes to DGK-iota Antibody (NBP1-85227). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DGK-iota Antibody (NBP1-85227)

Discover more about diseases related to DGK-iota Antibody (NBP1-85227).
 

Pathways for DGK-iota Antibody (NBP1-85227)

View related products by pathway.

PTMs for DGK-iota Antibody (NBP1-85227)

Learn more about PTMs related to DGK-iota Antibody (NBP1-85227).
 

Research Areas for DGK-iota Antibody (NBP1-85227)

Find related products by research area.

Blogs on DGK-iota

There are no specific blogs for DGK-iota, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DGK-iota Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DGKI
Entrez