RPL18A Antibody - BSA Free

Western Blot: RPL18A Antibody [NBP2-30708] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: RPL18A Antibody [NBP2-30708] - Staining of human cell line U-2 OS shows localization to nucleoli, cytosol & endoplasmic reticulum.

Immunohistochemistry: RPL18A Antibody [NBP2-30708] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells, islets of Langerhans were negative.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RPL18A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit RPL18A Antibody - BSA Free (NBP2-30708) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-RPL18A Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RAHSIQIMKVEEIAASKCRRPAVKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTFF
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RPL18A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RPL18A Protein (NBP2-30708PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25785838).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RPL18A Antibody - BSA Free

• 60S ribosomal protein L18a
• ribosomal protein L18a
• ribosomal protein L18a-like protein

Background

RPL18A, also referred to as 60S Ribosomal Protein L18A, is a component of the large 60S subunit of ribosomes. RPL18A is 176 amino acids in length and is approximately 20kDa. RPL18A has a high binding affinity for Importin 9, a nuclear transport receptor that averts aggregation of RPS7 and RPL18A in the cytoplasm. Current research on RPL18A has shown a possible link with hepatitis C, malaria and Treacher Collins syndrome. RPL18A has also been shown to interact with HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D and HIST1H4E.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RPL18A Antibody (NBP2-30708)(1)

Publication using NBP2-30708

• Kawada M, Inoue H, Ohba S et al. Stromal cells positively and negatively modulate the growth of cancer cells: stimulation via the PGE2-TNFalpha-IL-6 pathway and inhibition via secreted GAPDH-E-cadherin interaction. PLoS One 2015-01-01 [PMID: 25785838] (WB, ICC/IF, Human)

Bioinformatics

• Gene Symbol: RPL18A
• Uniprot:
  • Q02543(Human)