RPL18A Antibody

Images

 
Western Blot: RPL18A Antibody [NBP2-30708] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: RPL18A Antibody [NBP2-30708] - Staining of human cell line U-2 OS shows localization to nucleoli, cytosol & endoplasmic reticulum.
Immunohistochemistry: RPL18A Antibody [NBP2-30708] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells, islets of Langerhans were negative.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPL18A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RAHSIQIMKVEEIAASKCRRPAVKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTFF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPL18A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RPL18A Protein (NBP2-30708PEP)
Publications
Read Publication using
NBP2-30708 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25785838).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPL18A Antibody

  • 60S ribosomal protein L18a
  • ribosomal protein L18a
  • ribosomal protein L18a-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13251
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00058516-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-2269
Species: Hu, Mu
Applications: WB, IHC-P, IP
H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-80803
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87100
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33832
Species: Hu
Applications: IHC, IHC-P
NBP1-85385
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47278
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-06930
Species: Hu
MAB7158
Species: Hu, Mu
Applications: WB, IHC
H00006143-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-49581
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85062
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-42827
Species: Hu, Mu, Rt, Ch, Fi, Re, Xp
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-58707
Species: Hu
Applications: WB, ICC/IF
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-38971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33694
Species: Hu
Applications: IHC, IHC-P

Publications for RPL18A Antibody (NBP2-30708)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for RPL18A Antibody (NBP2-30708) (0)

There are no reviews for RPL18A Antibody (NBP2-30708). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RPL18A Antibody (NBP2-30708) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPL18A Products

Bioinformatics Tool for RPL18A Antibody (NBP2-30708)

Discover related pathways, diseases and genes to RPL18A Antibody (NBP2-30708). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for RPL18A Antibody (NBP2-30708)

View related products by pathway.

PTMs for RPL18A Antibody (NBP2-30708)

Learn more about PTMs related to RPL18A Antibody (NBP2-30708).

Blogs on RPL18A

There are no specific blogs for RPL18A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL18A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL18A
Uniprot