HT021 Antibody


Immunocytochemistry/ Immunofluorescence: HT021 Antibody [NBP2-14408] - Immunofluorescent staining of human cell line PC-3 shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: HT021 Antibody [NBP2-14408] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

HT021 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LFAQEIRLSKRHEEIVSQRLMLLQQMENKLGDQHTEKASQLQTVETAFKR NLSLLKDIEAAEKSL
Specificity of human HT021 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HT021 Protein (NBP2-14408PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for HT021 Antibody

  • C3orf14
  • chromosome 3 open reading frame 14
  • HT021
  • hypothetical protein LOC57415


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu, Mu
Applications: WB
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for HT021 Antibody (NBP2-14408) (0)

There are no publications for HT021 Antibody (NBP2-14408).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HT021 Antibody (NBP2-14408) (0)

There are no reviews for HT021 Antibody (NBP2-14408). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HT021 Antibody (NBP2-14408) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HT021 Products

Bioinformatics Tool for HT021 Antibody (NBP2-14408)

Discover related pathways, diseases and genes to HT021 Antibody (NBP2-14408). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HT021 Antibody (NBP2-14408)

Discover more about diseases related to HT021 Antibody (NBP2-14408).

Pathways for HT021 Antibody (NBP2-14408)

View related products by pathway.

PTMs for HT021 Antibody (NBP2-14408)

Learn more about PTMs related to HT021 Antibody (NBP2-14408).

Blogs on HT021

There are no specific blogs for HT021, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HT021 Antibody and receive a gift card or discount.


Gene Symbol C3ORF14