![Western Blot: DGAT2 Antibody [NBP2-92727] - Analysis of extracts of various cell lines, using DGAT2 antibody (NBP2-92727) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 90s.](http://images.novusbio.com/fullsize/DGAT2 Antibody-Western Blot-NBP2-92727-img0002.jpg "Western Blot: DGAT2 Antibody [NBP2-92727] - Analysis of extracts of various cell lines, using DGAT2 antibody (NBP2-92727) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 90s.")
| Reactivity | Mu, RtSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit DGAT2 Antibody - BSA Free (NBP2-92727) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 289-388 of human DGAT2 (NP_115953.2). IFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DGAT2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.09% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for DGAT2 Antibody (NBP2-92727)Find related products by research area.
|
|
Can you DGAT? DGAT1 & DGAT2 Antibodies for Metabolic Pathway Research Triacylglycerols (triglycerides) (TGs) are the major storage molecules of metabolic energy and FAs in most living organisms. Excessive accumulation of TGs, however, is associated with human diseases, such as obesity, diabetes mellitus, and steatohepat... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DGAT2 |
![Western Blot: DGAT2 Antibody [NBP2-92727] - Analysis of extracts of Rat liver cells, using DGAT2 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane._Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit .(Exposure time: 60s).](http://images.novusbio.com/fullsize/DGAT2-Antibody-Western-Blot-NBP2-92727-img0001.jpg "Western Blot: DGAT2 Antibody [NBP2-92727] - Analysis of extracts of Rat liver cells, using DGAT2 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane._Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit .(Exposure time: 60s).")
![Immunohistochemistry Thyroglobulin Antibody (904802) [Unconjugated]](https://images.novusbio.com/images2/Thyroglobulin_MAB8306_Immunohistochemistry_16477.jpg)
![Western Blot Thyroglobulin Antibody (904802) [Unconjugated]](https://images.novusbio.com/images2/Thyroglobulin_MAB8306_Western_Blot_16493.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot SCD-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/SCD-1_AF7550_Western_Blot_12344.jpg)
![Knockout Validated SCD-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/SCD1_AF7550_Knockout_Validated_24050.jpg)
![Knockout Validated SCD-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af7550_human-scd-1-affinity-purified-polyclonal-ab-20820241518560.png)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")