AWAT1 Antibody - BSA Free

Immunohistochemistry-Paraffin: AWAT1 Antibody [NBP2-49395] - Staining of human skin shows moderate cytoplasmic positivity in sebaceous cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AWAT1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: WVRNWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCT
• Predicted Species: Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AWAT1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  AWAT1 Recombinant Protein Antigen (NBP2-49395PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AWAT1 Antibody - BSA Free

• acyl-CoA wax alcohol acyltransferase 1
• DGA2
• DGAT2L3
• Diacylglycerol acyltransferase 2
• diacyl-glycerol acyltransferase 2
• diacylglycerol O-acyltransferase 2-like 3
• Diacylglycerol O-acyltransferase 2-like protein 3
• EC 2.3.1.75
• Long-chain-alcohol O-fatty-acyltransferase 1

Background

The protein encoded by the AWAT1 gene belongs to the diacylglycerol acyltransferase family. It esterifies long chain (wax)alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting thatthis enzyme plays a central role in lipid metabolism in skin. Consistent with this observation, this protein ispredominantly expressed in the sebaceous gland of the skin. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AWAT1