Desmoglein-2 Antibody

Images

 
Western Blot: Desmoglein 2 Antibody [NBP1-59200] - Titration: 1 ug/ml Positive Control: Hela cell lysate.
Immunohistochemistry-Paraffin: Desmoglein 2 Antibody [NBP1-59200] - Human Colon tissue at an antibody concentration of 5.0ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Desmoglein-2 Antibody Summary

Immunogen
Synthetic peptides corresponding to DSG2(desmoglein 2) The peptide sequence was selected from the N terminal of DSG2 (NP_001934). Peptide sequence KIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DSG2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 5 ug/ml
Application Notes
This is a rabbit polyclonal antibody against DSG2 and was validated on Western blot.
Theoretical MW
114 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Desmoglein-2 Antibody

  • ARVC10
  • ARVD10
  • Cadherin family member 5
  • CDHF5
  • CDHF5MGC117034
  • CMD1BB
  • desmoglein 2
  • Desmoglein2
  • Desmoglein-2
  • DSG2
  • HDGC
  • MGC117036
  • MGC117037

Background

Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. DSG2 is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. This second family member is expressed in colon, colon carcinoma, and other simple and stratified epithelial-derived cell lines.Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. This gene product is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. This second family member is expressed in colon, colon carcinoma, and other simple and stratified epithelial-derived cell lines. Mutations in this gene have been associated with arrhythmogenic right ventricular dysplasia, familial, 10. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF7490
Species: Mu
Applications: IHC
MAB944
Species: Hu
Applications: WB, IHC
NBP1-86078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7265
Species: Mu
Applications: WB, IHC
NBP1-78984
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
46780002
Species: Hu
Applications: ELISA
NBP2-37557
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88099
Species: Hu
Applications: Simple Western, IHC, IHC-P
NBP1-46852
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP1-84132
Species: Hu
Applications: IHC, IHC-P
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for Desmoglein-2 Antibody (NBP1-59200) (0)

There are no publications for Desmoglein-2 Antibody (NBP1-59200).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Desmoglein-2 Antibody (NBP1-59200) (0)

There are no reviews for Desmoglein-2 Antibody (NBP1-59200). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Desmoglein-2 Antibody (NBP1-59200) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Desmoglein-2 Products

Bioinformatics Tool for Desmoglein-2 Antibody (NBP1-59200)

Discover related pathways, diseases and genes to Desmoglein-2 Antibody (NBP1-59200). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Desmoglein-2 Antibody (NBP1-59200)

Discover more about diseases related to Desmoglein-2 Antibody (NBP1-59200).
 

Pathways for Desmoglein-2 Antibody (NBP1-59200)

View related products by pathway.

PTMs for Desmoglein-2 Antibody (NBP1-59200)

Learn more about PTMs related to Desmoglein-2 Antibody (NBP1-59200).

Blogs on Desmoglein-2

There are no specific blogs for Desmoglein-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Desmoglein-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DSG2
Entrez
Uniprot