TMEM43 Antibody

Images

 
Immunohistochemistry-Paraffin: TMEM43 Antibody [NBP1-84132] - Staining of human prostate shows weak positivity in nuclear membrane in glandular cells, as well as in smooth muscle cells.
Immunohistochemistry-Paraffin: TMEM43 Antibody [NBP1-84132] - Staining of human skin shows moderate to strong positivity in nuclear membrane in keratinocytes.
Immunohistochemistry-Paraffin: TMEM43 Antibody [NBP1-84132] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM43 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FKSLSLSKLEDPHVDIIRRGDFFYHSENPKYPEVGDLRVSFSYAGLSGDDPDLGPAHVVTVIARQRGDQLVPFSTKSGDTLLLLHHGDFSAEEVFHRELRSNSMKT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM43
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TMEM43 Protein (NBP1-84132PEP)
Publications
Read Publications using NBP1-84132.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMEM43 Antibody

  • ARVC5
  • ARVD5
  • DKFZp586G1919
  • LUMA
  • MGC3222
  • Protein LUMA
  • transmembrane protein 43

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-86078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF947
Species: Hu
Applications: WB, Simple Western
NBP1-87692
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
AF7490
Species: Mu
Applications: IHC
NBP1-91612
Species: Mu
Applications: WB
NBP2-59942
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-37557
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
MAB7265
Species: Mu
Applications: WB, IHC
NBP1-90091
Species: Hu
Applications: IHC, IHC-P
PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
NBP1-57749
Species: Hu
Applications: WB, IHC
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-01998
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for TMEM43 Antibody (NBP1-84132)(2)


Showing Publications 1 - 2 of 2.
Publications using NBP1-84132 Applications Species
Christensen AH, Andersen CB, Tybjaerg-Hansen A et al. Mutation analysis and evaluation of the cardiac localization of TMEM43 in arrhythmogenic right ventricular cardiomyopathy. Clin Genet 2011 Sep [PMID: 21214875]
Gry M, Oksvold P, Ponten F et al. Tissue-specific protein expression in human cells, tissues and organs. J Proteomics Bioinform 2010

Reviews for TMEM43 Antibody (NBP1-84132) (0)

There are no reviews for TMEM43 Antibody (NBP1-84132). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TMEM43 Antibody (NBP1-84132) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM43 Products

Bioinformatics Tool for TMEM43 Antibody (NBP1-84132)

Discover related pathways, diseases and genes to TMEM43 Antibody (NBP1-84132). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM43 Antibody (NBP1-84132)

Discover more about diseases related to TMEM43 Antibody (NBP1-84132).
 

Pathways for TMEM43 Antibody (NBP1-84132)

View related products by pathway.

Blogs on TMEM43

There are no specific blogs for TMEM43, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM43 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM43