Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Format | BSA Free |
Description | Novus Biologicals Rabbit TMEM43 Antibody - BSA Free (NBP1-84132) is a polyclonal antibody validated for use in IHC and WB. Anti-TMEM43 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FKSLSLSKLEDPHVDIIRRGDFFYHSENPKYPEVGDLRVSFSYAGLSGDDPDLGPAHVVTVIARQRGDQLVPFSTKSGDTLLLLHHGDFSAEEVFHRELRSNSMKT |
Predicted Species | Mouse (92%), Rat (92%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | TMEM43 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publications using NBP1-84132 | Applications | Species |
---|---|---|
Gry M, Oksvold P, Ponten F et al. Tissue-specific protein expression in human cells, tissues and organs. J Proteomics Bioinform 2010-01-01 | ||
Jang MW, Kim TY, Sharma K Et al. A Deafness Associated Protein TMEM43 Interacts with KCNK3 (TASK-1) Two-pore Domain K+ (K2P) Channel in the Cochlea Experimental neurobiology 2021-10-31 [PMID: 34737237] (WB, PLA, IF/IHC) | WB, PLA, IF/IHC | |
Christensen AH, Andersen CB, Tybjaerg-Hansen A et al. Mutation analysis and evaluation of the cardiac localization of TMEM43 in arrhythmogenic right ventricular cardiomyopathy. Clin Genet 2011-09-01 [PMID: 21214875] |
Secondary Antibodies |
Isotype Controls |
Research Areas for TMEM43 Antibody (NBP1-84132)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | TMEM43 |