Desmocollin-3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Desmocollin-3 Antibody [NBP2-56621] - Staining of human cell line U-2 OS shows localization to plasma membrane & cell junctions.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Desmocollin-3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PDFRVLNDGSVYTARAVALSDKKRSFTIWLSDKRKQTQKEVTVLLEHQKKVSKTRHTRET
Specificity
Specificity of human Desmocollin-3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DSC3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Desmocollin-3 Recombinant Protein Antigen (NBP2-56621PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Desmocollin-3 Antibody

  • Cadherin family member 3
  • CDHF3
  • CDHF3HT-CP
  • desmocollin 3
  • Desmocollin3
  • Desmocollin-3
  • desmocollin-4
  • DSC
  • DSC1
  • DSC2
  • DSC3
  • DSC4
  • DSC4desmocollin-3
  • HT-CP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
AF944
Species: Hu
Applications: WB, IHC
NBP1-78984
Species: Hu, Mu
Applications: WB, DB, ICC/IF, IHC, IHC-P, IP
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75469
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF3894
Species: Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ICC
NB100-56146
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-84597
Species: Hu
Applications: WB, IHC, IHC-P
44260002
Species: Hu
Applications: WB, ELISA
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
NB100-64959
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr
NBL1-16214
Species: Hu
NBP2-12553
Species: Hu
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-86078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Desmocollin-3 Antibody (NBP2-56621) (0)

There are no publications for Desmocollin-3 Antibody (NBP2-56621).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Desmocollin-3 Antibody (NBP2-56621) (0)

There are no reviews for Desmocollin-3 Antibody (NBP2-56621). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Desmocollin-3 Antibody (NBP2-56621) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Desmocollin-3 Products

Bioinformatics Tool for Desmocollin-3 Antibody (NBP2-56621)

Discover related pathways, diseases and genes to Desmocollin-3 Antibody (NBP2-56621). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Desmocollin-3 Antibody (NBP2-56621)

Discover more about diseases related to Desmocollin-3 Antibody (NBP2-56621).
 

Pathways for Desmocollin-3 Antibody (NBP2-56621)

View related products by pathway.

PTMs for Desmocollin-3 Antibody (NBP2-56621)

Learn more about PTMs related to Desmocollin-3 Antibody (NBP2-56621).

Blogs on Desmocollin-3

There are no specific blogs for Desmocollin-3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Desmocollin-3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DSC3