Desmin Antibody (6O9O4)

Immunohistochemistry: Desmin Antibody (6O9O4) [NBP3-33531] - Immunohistochemistry analysis of paraffin-embedded Human prostate cancer tissue using Desmin Rabbit mAb at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Western Blot: Desmin Antibody (6O9O4) [NBP3-33531] - Western blot analysis of various lysates using Desmin Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

Immunohistochemistry: Desmin Antibody (6O9O4) [NBP3-33531] - Immunohistochemistry analysis of paraffin-embedded Human prostate cancer tissue using Desmin Rabbit mAb at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Desmin Antibody (6O9O4) [NBP3-33531] - Immunohistochemistry analysis of paraffin-embedded Human thyroid tissue using Desmin Rabbit mAb at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Desmin Antibody (6O9O4) [NBP3-33531] - Immunohistochemistry analysis of paraffin-embedded Human lung tissue using Desmin Rabbit mAb at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Desmin Antibody (6O9O4) [NBP3-33531] - Immunohistochemistry analysis of paraffin-embedded Human stomach tissue using Desmin Rabbit mAb at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Desmin Antibody (6O9O4) [NBP3-33531] - Immunohistochemistry analysis of paraffin-embedded Human smooth muscle tissue using Desmin Rabbit mAb at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 6O9O4
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Desmin Antibody (6O9O4) Summary

• Description: Novus Biologicals Rabbit Desmin Antibody (6O9O4) (NBP3-33531) is a monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 371-470 of human Desmin (P17661).
  
  Sequence:
  EEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: DES
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:5000
  • Western Blot 1:1000 - 1:5000
• Theoretical MW: 54 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Desmin Antibody (6O9O4)

• CMD1I
• CMD1IFLJ41013
• CSM1
• CSM2
• DES
• Desmin
• FLJ12025
• FLJ39719
• FLJ41793
• intermediate filament protein

Background

Desmin is the protein subunit of muscle-type intermediate filaments (IFs). Desmin is one of the five major groups of IFs and is found predominantly in skeletal, cardiac, and smooth muscle.DE-U-10 labels desmin in tumors derived from muscle tissue (leiomyomas and rhabdomyosarcomas) (Debus E et al.).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DES