DERP13 Antibody

Images

 
Immunohistochemistry-Paraffin: DERP13 Antibody [NBP1-84272] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DERP13 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HAMLATLARVAALRRTCLFSGRGGGRGLWTGRPQSDMNNIKPLEGVKILDLTRVLAGPFATMNLGDLGAEVIKVERPGAGDDTRTW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C7ORF10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DERP13 Protein (NBP1-84272PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DERP13 Antibody

  • C7orf10
  • CaiB/baiF CoA-transferase family protein C7orf10
  • chromosome 7 open reading frame 10
  • Dermal papilla-derived protein 13
  • DERP13
  • DERP13FLJ11808
  • EC 2.-
  • FLJ53872
  • ORF19
  • Russel-Silver syndrome candidate

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31718
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
MAB8508
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-69668
Species: Hu
Applications: WB
NB110-58345
Species: Hu, Mu, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-60017
Species: Hu, Mu
Applications: WB
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NB100-885
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-94712
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-57758
Species: Hu
Applications: ICC/IF
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-85064
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84272
Species: Hu
Applications: IHC, IHC-P

Publications for DERP13 Antibody (NBP1-84272) (0)

There are no publications for DERP13 Antibody (NBP1-84272).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DERP13 Antibody (NBP1-84272) (0)

There are no reviews for DERP13 Antibody (NBP1-84272). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DERP13 Antibody (NBP1-84272) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DERP13 Products

Bioinformatics Tool for DERP13 Antibody (NBP1-84272)

Discover related pathways, diseases and genes to DERP13 Antibody (NBP1-84272). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DERP13 Antibody (NBP1-84272)

Discover more about diseases related to DERP13 Antibody (NBP1-84272).

Blogs on DERP13

There are no specific blogs for DERP13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DERP13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C7ORF10