PIGW Antibody (1D8) - Azide and BSA Free

Western Blot: PIGW Antibody (1D8) [H00284098-M05-100ug] - Detection against Immunogen (31.13 KDa) .

Western Blot: PIGW Antibody (1D8) [H00284098-M05-100ug] - Analysis of PIGW expression in MCF-7.

ELISA: PIGW Antibody (1D8) [H00284098-M05-100ug] - Detection limit for recombinant GST tagged PIGW is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1D8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PIGW Antibody (1D8) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse PIGW Antibody (1D8) - Azide and BSA Free (H00284098-M05-100ug) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: PIGW (NP_848612.2, 399 a.a. ~ 447 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KFLIKGALVPCSWKLIQSPVTNKKHSESLVPEAERMEPSLCLITALNRK
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PIGW
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A or G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PIGW Antibody (1D8) - Azide and BSA Free

• class W
• EC 2.3
• FLJ37433
• phosphatidylinositol glycan anchor biosynthesis, class W
• PIG-W

Background

Glycosylphosphatidylinositol (GPI) is a complex glycolipid that anchors many proteins to the cell surface. PIGW acts in the third step of GPI biosynthesis and acylates the inositol ring of phosphatidylinositol (Murakami et al., 2003 [PubMed 14517336]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PIGW
• Entrez:
  • 284098(Human)
• OMIM:
  • 610275(Human)
• Uniprot:
  • NP_848612.2(Human)