DGK-zeta Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit DGK-zeta Antibody - BSA Free (NBP2-13918) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the amino acids: EHLNYVTEIAQDEIYILDPELLGASARPDLPTPTSPLPTSPCSPTPRSLQGDAAPPQGEELIEAAKRNDFCKLQE |
| Predicted Species |
Mouse (92%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DGKZ |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for DGK-zeta Antibody - BSA Free
Background
DGKZ, also known as Diacylglycerol kinase zeta, consists of six isoforms of sizes 124.1 kDa, 104 kDa, 106 kDa, 104.1 kDa, 104.6 kDa, and 101.2 kDa and is involved in regulating the amount of diacylglycerol in signal transduction pathways as a member of the eukaryotic diacylglycerol kinase family. Current research is exploring the effect of the protein on diseases such as malaria, retinoblastoma, cerebritis, bipolar disorder, and cerebral infarction. The protein interacts with RB1, RBL1, RBL2, MAPK6, and GCOM1 while in glycerolipid metabolism, hemostasis, PIP2 hydrolysis, and signal transduction pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, ICFlow, Neut, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P
Species: Pm, Hu
Applications: ICC/IF, WB
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Publications for DGK-zeta Antibody (NBP2-13918) (0)
There are no publications for DGK-zeta Antibody (NBP2-13918).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DGK-zeta Antibody (NBP2-13918) (0)
There are no reviews for DGK-zeta Antibody (NBP2-13918).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DGK-zeta Antibody (NBP2-13918) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DGK-zeta Products
Research Areas for DGK-zeta Antibody (NBP2-13918)
Find related products by research area.
|
Blogs on DGK-zeta