Deoxycytidylate deaminase Antibody

Images

 
Western Blot: Deoxycytidylate deaminase Antibody [NBP1-87424] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-160
Immunocytochemistry/ Immunofluorescence: Deoxycytidylate deaminase Antibody [NBP1-87424] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Deoxycytidylate deaminase Antibody [NBP1-87424] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Deoxycytidylate deaminase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QPCGPNMSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DCTD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Deoxycytidylate deaminase Protein (NBP1-87424PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Deoxycytidylate deaminase Antibody

  • dCMP deaminaseEC 3.5.4.12
  • deoxycytidylate deaminase
  • MGC111062

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43639
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-57516
Species: Hu
Applications: WB
NBP2-01184
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53089
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-86274
Species: Hu
Applications: WB, IHC, IHC-P, INHIB T-cell
AF4245
Species: Hu
Applications: WB, IP
NBP2-33277
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-50508
Species: Hu, Mu, Rt
Applications: WB, IHC-P
H00006241-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Deoxycytidylate deaminase Antibody (NBP1-87424) (0)

There are no publications for Deoxycytidylate deaminase Antibody (NBP1-87424).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Deoxycytidylate deaminase Antibody (NBP1-87424) (0)

There are no reviews for Deoxycytidylate deaminase Antibody (NBP1-87424). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Deoxycytidylate deaminase Antibody (NBP1-87424) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Deoxycytidylate deaminase Products

Bioinformatics Tool for Deoxycytidylate deaminase Antibody (NBP1-87424)

Discover related pathways, diseases and genes to Deoxycytidylate deaminase Antibody (NBP1-87424). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Deoxycytidylate deaminase Antibody (NBP1-87424)

Discover more about diseases related to Deoxycytidylate deaminase Antibody (NBP1-87424).
 

Pathways for Deoxycytidylate deaminase Antibody (NBP1-87424)

View related products by pathway.

PTMs for Deoxycytidylate deaminase Antibody (NBP1-87424)

Learn more about PTMs related to Deoxycytidylate deaminase Antibody (NBP1-87424).
 

Research Areas for Deoxycytidylate deaminase Antibody (NBP1-87424)

Find related products by research area.

Blogs on Deoxycytidylate deaminase

There are no specific blogs for Deoxycytidylate deaminase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Deoxycytidylate deaminase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DCTD