dUTPase Antibody

Images

 
Western Blot: dUTPase Antibody [NBP2-33277] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: dUTPase Antibody [NBP2-33277] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: dUTPase Antibody [NBP2-33277] - Staining of liver cancer.
Immunohistochemistry: dUTPase Antibody [NBP2-33277] - Staining of human tonsil shows strong cytoplasmic and nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: dUTPase Antibody [NBP2-33277] - Staining of liver.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

dUTPase Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DUT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000 - 1:2500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
dUTPase Protein (NBP2-33277PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for dUTPase Antibody

  • deoxyuridine triphosphatase
  • dUTP pyrophosphatasedUTP nucleotidohydrolase
  • dUTPasedeoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
  • EC 3.6.1.23
  • FLJ20622

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB600-1031
Species: Hu, Mu, Rt, Rb
Applications: WB, ICC/IF, IHC-P
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-87424
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-57200
Species: Hu
Applications: ICC/IF
NBP2-01184
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA

Publications for dUTPase Antibody (NBP2-33277) (0)

There are no publications for dUTPase Antibody (NBP2-33277).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for dUTPase Antibody (NBP2-33277) (0)

There are no reviews for dUTPase Antibody (NBP2-33277). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for dUTPase Antibody (NBP2-33277) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional dUTPase Products

Bioinformatics Tool for dUTPase Antibody (NBP2-33277)

Discover related pathways, diseases and genes to dUTPase Antibody (NBP2-33277). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for dUTPase Antibody (NBP2-33277)

Discover more about diseases related to dUTPase Antibody (NBP2-33277).
 

Pathways for dUTPase Antibody (NBP2-33277)

View related products by pathway.

PTMs for dUTPase Antibody (NBP2-33277)

Learn more about PTMs related to dUTPase Antibody (NBP2-33277).
 

Research Areas for dUTPase Antibody (NBP2-33277)

Find related products by research area.

Blogs on dUTPase

There are no specific blogs for dUTPase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our dUTPase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DUT
Uniprot