dUTPase Antibody


Western Blot: dUTPase Antibody [NBP2-33277] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: dUTPase Antibody [NBP2-33277] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: dUTPase Antibody [NBP2-33277] - Staining in human lymph node and skeletal muscle tissues using anti-DUT antibody. Corresponding DUT RNA-seq data are presented for the same tissues.
Immunohistochemistry: dUTPase Antibody [NBP2-33277] - Staining of human tonsil shows strong cytoplasmic and nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: dUTPase Antibody [NBP2-33277] - Staining of liver.
Immunohistochemistry-Paraffin: dUTPase Antibody [NBP2-33277] - Staining of liver cancer.
Immunohistochemistry-Paraffin: dUTPase Antibody [NBP2-33277] - Staining of human lymph node shows high expression.
Immunohistochemistry-Paraffin: dUTPase Antibody [NBP2-33277] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

dUTPase Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: SGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSG
Specificity of human dUTPase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
dUTPase Protein (NBP2-33277PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for dUTPase Antibody

  • deoxyuridine triphosphatase
  • dUTP pyrophosphatasedUTP nucleotidohydrolase
  • dUTPasedeoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
  • EC
  • FLJ20622


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Rb
Applications: WB, ICC/IF, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA

Publications for dUTPase Antibody (NBP2-33277) (0)

There are no publications for dUTPase Antibody (NBP2-33277).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for dUTPase Antibody (NBP2-33277) (0)

There are no reviews for dUTPase Antibody (NBP2-33277). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for dUTPase Antibody (NBP2-33277) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional dUTPase Products

Bioinformatics Tool for dUTPase Antibody (NBP2-33277)

Discover related pathways, diseases and genes to dUTPase Antibody (NBP2-33277). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for dUTPase Antibody (NBP2-33277)

Discover more about diseases related to dUTPase Antibody (NBP2-33277).

Pathways for dUTPase Antibody (NBP2-33277)

View related products by pathway.

PTMs for dUTPase Antibody (NBP2-33277)

Learn more about PTMs related to dUTPase Antibody (NBP2-33277).

Research Areas for dUTPase Antibody (NBP2-33277)

Find related products by research area.

Blogs on dUTPase

There are no specific blogs for dUTPase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our dUTPase Antibody and receive a gift card or discount.


Gene Symbol DUT