DENR Antibody

Western Blot: DENR Antibody [NBP2-13913] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Immunocytochemistry/Immunofluorescence: DENR Antibody [NBP2-13913] - Immunofluorescent staining of human cell line SiHa shows localization to cytosol.

Immunohistochemistry-Paraffin: DENR Antibody [NBP2-13913] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferus ducts.

Western Blot: DENR Antibody [NBP2-13913] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-159

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

DENR Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: AADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DENR
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DENR Protein (NBP2-13913PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DENR Antibody

• density-regulated protein
• DRP1Protein DRP1
• DRPsmooth muscle cell associated protein-3
• SMAP-3
• Smooth muscle cell-associated protein 3

Background

DENR encodes a protein whose expression was found to increase in cultured cells at high density but not during growth arrest. This gene was also shown to have increased expression in cells overexpressing HER-2/neu proto-oncogene. The protein contains an SUI1 domain. In budding yeast, SUI1 is a translation initiation factor that along with eIF-2 and the initiator tRNA-Met, directs the ribosome to the proper translation start site. Proteins similar to SUI have been found in mammals, insects, and plants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DENR Antibody (NBP2-13913)(1)

Publication using NBP2-13913

• Aina-Badejo D Elucidating the Unknown Role of Cyclin Dependent Kinase 5 in Cardiac Pathophysiological Conditions Thesis 1905-07-13 (IF/IHC)

Bioinformatics

• Gene Symbol: DENR