DEGS1 Antibody - Azide and BSA Free

Western Blot: DEGS1 Antibody [NBP2-92082] - Analysis of extracts of various cell lines, using DEGS1 at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

DEGS1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit DEGS1 Antibody - Azide and BSA Free (NBP2-92082) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 234-323 of human DEGS1 (NP_003667.1). YMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DEGS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:1000-1:3000
• Theoretical MW: 37 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for DEGS1 Antibody - Azide and BSA Free

• Cell migration-inducing gene 15 protein
• Degenerative spermatocyte homolog 1
• degenerative spermatocyte homolog 1, lipid desaturase (Drosophila)
• degenerative spermatocyte homolog, lipid desaturase (Drosophila)
• DEGS
• DEGS1
• DES1
• Des-1
• DES1degenerative spermatocyte homolog, lipid desaturase
• EC 1.14
• EC 1.14.19.17
• EC 5.2.1.-
• FADS7
• membrane fatty acid (lipid) desaturase
• Membrane lipid desaturase
• MGC5079
• MIG15
• migration-inducing gene 15 protein
• MLDdihydroceramide desaturase
• Retinol isomerase
• sphingolipid delta 4 desaturase
• sphingolipid delta(4)-desaturase DES1

Background

DEGS1 encodes a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this gene inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor. Two splice variants have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: DEGS1