Defensin alpha 4 Antibody - BSA Free

Immunohistochemistry-Paraffin: Defensin alpha 4 Antibody [NBP2-13910] - Staining of human lymph node shows positivity in lymphoid cells.

Immunohistochemistry-Paraffin: Defensin alpha 4 Antibody [NBP2-13910] - Staining of human bone marrow shows positivity in hematopoietic cells.

Immunohistochemistry-Paraffin: Defensin alpha 4 Antibody [NBP2-13910] - Staining of human cerebral cortex shows no positivity as expected.

Immunohistochemistry-Paraffin: Defensin alpha 4 Antibody [NBP2-13910] - Staining of human duodenum shows positivity in lymphoid cells.

Immunohistochemistry-Paraffin: Defensin alpha 4 Antibody [NBP2-13910] - Staining in human bone marrow and cerebral cortex tissues . Corresponding DEFA4 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Defensin alpha 4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SSALQVSGSTRGMVCSCRLVFCRRTELRVGNCLIGGVSFTYCCTRVD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DEFA4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Defensin alpha 4 Protein (NBP2-13910PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Defensin alpha 4 Antibody - BSA Free

• corticostatin
• DEF4
• defensin, alpha 4, corticostatin
• defensin, alpha 4, preproprotein
• HNP-4
• HP4
• HP-4
• MGC120099
• MGC138296
• neutrophil defensin 4

Background

Human neutrophil alpha-defensins (also designated HNPs) are small, cationic, cysteine-rich antimicrobial proteins that play important roles in innate immunity against infectious microbes such as bacteria, fungi and enveloped viruses. Alpha-defensins are synthesized as inactive precursors and are activated by proteolytic cleavage by MMP-7. Paneth cells in small intestinal crypts secrete the alpha-defensins, which are also termed cryptidins in mice. The cryptidin-4 gene is unique among the Paneth cell alpha defensins in that it is inactive in the duodenum, but expressed at maximal levels in the distal small bowel.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Defensin alpha 4 Antibody (NBP2-13910)(1)

Publication using NBP2-13910

• Cox SN, Chiurlia S, Divella C et al. Formalin-fixed paraffin-embedded renal biopsy tissues: an underexploited biospecimen resource for gene expression profiling in IgA nephropathy Scientific reports 2020-09-16 [PMID: 32938960] (IHC-P, Human)

Bioinformatics

• Gene Symbol: DEFA4