Defensin alpha 4 Antibody


Immunohistochemistry-Paraffin: Defensin alpha 4 Antibody [NBP2-13910] - Staining of human lymph node shows positivity in lymphoid cells.
Immunohistochemistry-Paraffin: Defensin alpha 4 Antibody [NBP2-13910] - Staining of human bone marrow shows positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: Defensin alpha 4 Antibody [NBP2-13910] - Staining of human cerebral cortex shows no positivity as expected.
Immunohistochemistry-Paraffin: Defensin alpha 4 Antibody [NBP2-13910] - Staining of human duodenum shows positivity in lymphoid cells.
Immunohistochemistry-Paraffin: Defensin alpha 4 Antibody [NBP2-13910] - Staining in human bone marrow and cerebral cortex tissues. Corresponding DEFA4 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Defensin alpha 4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SSALQVSGSTRGMVCSCRLVFCRRTELRVGNCLIGGVSFTYCCTRVD
Specificity of human Defensin alpha 4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Defensin alpha 4 Protein (NBP2-13910PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Defensin alpha 4 Antibody

  • corticostatin
  • DEF4
  • defensin, alpha 4, corticostatin
  • defensin, alpha 4, preproprotein
  • HNP-4
  • HP4
  • HP-4
  • MGC120099
  • MGC138296
  • neutrophil defensin 4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ELISA, IHC
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, DB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu
Applications: WB, IP

Publications for Defensin alpha 4 Antibody (NBP2-13910) (0)

There are no publications for Defensin alpha 4 Antibody (NBP2-13910).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Defensin alpha 4 Antibody (NBP2-13910) (0)

There are no reviews for Defensin alpha 4 Antibody (NBP2-13910). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Defensin alpha 4 Antibody (NBP2-13910) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Defensin alpha 4 Products

Bioinformatics Tool for Defensin alpha 4 Antibody (NBP2-13910)

Discover related pathways, diseases and genes to Defensin alpha 4 Antibody (NBP2-13910). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Defensin alpha 4 Antibody (NBP2-13910)

Discover more about diseases related to Defensin alpha 4 Antibody (NBP2-13910).

Pathways for Defensin alpha 4 Antibody (NBP2-13910)

View related products by pathway.

Blogs on Defensin alpha 4

There are no specific blogs for Defensin alpha 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Defensin alpha 4 Antibody and receive a gift card or discount.


Gene Symbol DEFA4