Recombinant Human Defensin alpha 3 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Defensin alpha 3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-94 of Human DEFA3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
DEFA3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Defensin alpha 3 Protein

  • DEF3
  • Defensin, alpha 3
  • defensin, alpha 3, neutrophil-specific
  • HNP3
  • HNP-3defensin 3, neutrophil-specific
  • HP3
  • HP-3
  • neutrophil defensin 3
  • neutrophil peptide 3

Background

Defensins are a family of microbicidal and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 3, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. It differs from defensin, alpha 1 by only one amino acid. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF8198
Species: Hu
Applications: ELISA, IHC
NB110-40623
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP
NBP2-33498
Species: Hu
Applications: IHC, IHC-P
NBP1-25966
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-37982
Species: Hu
Applications: IHC, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP2-57614
Species: Hu
Applications: ICC/IF
H00008706-P01
Species: Hu
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF2758
Species: Hu
Applications: WB, IHC
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP

Publications for Defensin alpha 3 Recombinant Protein (H00001668-P01) (0)

There are no publications for Defensin alpha 3 Recombinant Protein (H00001668-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Defensin alpha 3 Recombinant Protein (H00001668-P01) (0)

There are no reviews for Defensin alpha 3 Recombinant Protein (H00001668-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Defensin alpha 3 Recombinant Protein (H00001668-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Array H00001668-P01

Bioinformatics Tool for Defensin alpha 3 Recombinant Protein (H00001668-P01)

Discover related pathways, diseases and genes to Defensin alpha 3 Recombinant Protein (H00001668-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Defensin alpha 3 Recombinant Protein (H00001668-P01)

Discover more about diseases related to Defensin alpha 3 Recombinant Protein (H00001668-P01).
 

Pathways for Defensin alpha 3 Recombinant Protein (H00001668-P01)

View related products by pathway.

Blogs on Defensin alpha 3

There are no specific blogs for Defensin alpha 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Defensin alpha 3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DEFA3