DEFA6 Antibody - BSA Free

Immunohistochemistry-Paraffin: DEFA6 Antibody [NBP1-84281] - Analysis in human small intestine and cerebral cortex tissues using NBP1-84281 antibody. Corresponding DEFA6 RNA-seq data are presented for the same tissues.

Western Blot: DEFA6 Antibody [NBP1-84281] - Analysis in human small intestine tissue.

Immunohistochemistry-Paraffin: DEFA6 Antibody [NBP1-84281] - Staining of human duodenum shows cytoplasmic positivity in Paneth cells.

Simple Western: DEFA6 Antibody [NBP1-84281] - Western lane view shows lysates of Ileum stem cells day 9 differentiated and day 12 differentiated, loaded at 0.2 mg/mL. A specific band was detected for DEFA6 at approximately 15 kDa (as indicated) using 4 ug/mL of Rabbit Anti-DEFA6 Polyclonal Antibody (Catalog # NBP1-84281). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.

DEFA6 Antibody [NBP1-84281]-Staining of human rectum shows no positivity in glandular cells as expected.

DEFA6 Antibody [NBP1-84281]-Staining of human cerebral cortex shows no cytoplasmic positivity in neuronal cells as expected.

Staining of human small intestine shows strong cytoplasmic positivity in Paneth cells.

Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DEFA6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DEFA6 Antibody - BSA Free (NBP1-84281) is a polyclonal antibody validated for use in IHC, WB and Simple Western. Anti-DEFA6 Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DEFA6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
  • Simple Western 4 ug/mL
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
  See Simple Western Antibody Database for Simple Western validation: Tested in Ileum stem cells day 9 differentiated and day 12 differentiated, separated by Size, antibody dilution of 4 ug/mL, apparent MW was 15 kDa
• Control Peptide:

  DEFA6 Protein (NBP1-84281PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DEFA6 Antibody - BSA Free

• DEF6HD-6
• defensin 6
• Defensin, alpha 6
• defensin, alpha 6, Paneth cell-specific
• defensin-6

Background

Defensins are a family of microbicidal and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 6, is highly expressed in the secretory granules of Paneth cells of the small intestine, and likely plays a role in host defense of human bowel. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DEFA6 Antibody (NBP1-84281)(4)

Publications using NBP1-84281

• A Lebeau, D Bruyere, P Roncarati, P Peixoto, E Hervouet, G Cobraivill, B Taminiau, M Masson, C Gallego, G Mazzucchel, N Smargiasso, M Fleron, D Baiwir, E Hendrick, C Pilard, T Lerho, C Reynders, M Ancion, R Greimers, JC Twizere, G Daube, G Schlecht-L, F Bachelerie, JD Combes, P Melin, M Fillet, P Delvenne, P Hubert, M Herfs HPV infection alters vaginal microbiome through down-regulating host mucosal innate peptides used by Lactobacilli as amino acid sources Nature Communications, 2022-02-28;13(1):1076. 2022-02-28 [PMID: 35228537]
• Lucero CM, Fallert Junecko B, Klamar CR et al. Macaque Paneth Cells Express Lymphoid Chemokine CXCL13 and Other Antimicrobial Peptides Not Previously Described as Expressed in Intestinal Crypts. Clin Vaccine Immunol 2013-08-01 [PMID: 23803902]
• van Beelen Granlund A, Ostvik AE, Brenna O et al. REG gene expression in inflamed and healthy colon mucosa explored by in situ hybridisation. Cell Tissue Res 2013-06-01 [PMID: 23519454]
• Granlund Av, Beisvag V, Torp SH et al. Activation of REG family proteins in colitis. Scand J Gastroenterol 2011-11-01 [PMID: 21992413]

Bioinformatics

• Gene Symbol: DEFA6