DEFA6 Antibody

Images

 
Western Blot: DEFA6 Antibody [NBP1-84281] - Analysis in human small intestine tissue.
Orthogonal Strategies: Immunohistochemistry-Paraffin: DEFA6 Antibody [NBP1-84281] - Staining in human small intestine and liver tissues. Corresponding DEFA6 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DEFA6 Antibody [NBP1-84281] - Staining of human duodenum shows cytoplasmic positivity in Paneth cells.
Immunohistochemistry-Paraffin: DEFA6 Antibody [NBP1-84281] - Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: DEFA6 Antibody [NBP1-84281] - Staining of human small intestine shows cytoplasmic positivity in Paneth cells.
Simple Western: DEFA6 Antibody [NBP1-84281] - Western lane view shows lysates of Ileum stem cells day 9 differentiated and day 12 differentiated, loaded at 0.2 mg/mL. A specific band was detected for DEFA6 at ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

DEFA6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFC
Specificity
Specificity of human DEFA6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DEFA6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Simple Western
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DEFA6 Protein (NBP1-84281PEP)
Publications
Read Publications using NBP1-84281.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23519454)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DEFA6 Antibody

  • DEF6HD-6
  • defensin 6
  • Defensin, alpha 6
  • defensin, alpha 6, Paneth cell-specific
  • defensin-6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-60002
Species: Hu
Applications: WB, DB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-19083
Species: Hu
Applications: WB, ICC/IF
AF2758
Species: Hu
Applications: WB, IHC
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-82979
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB100-55735
Species: Hu, Mu, Bv, Ca, Ch, Pm
Applications: WB, ICC/IF, IP
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-61118
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF8198
Species: Hu
Applications: ELISA, IHC
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NB110-60928
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, EM, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
NBP1-84281
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P

Publications for DEFA6 Antibody (NBP1-84281)(3)

Reviews for DEFA6 Antibody (NBP1-84281) (0)

There are no reviews for DEFA6 Antibody (NBP1-84281). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DEFA6 Antibody (NBP1-84281) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DEFA6 Products

Bioinformatics Tool for DEFA6 Antibody (NBP1-84281)

Discover related pathways, diseases and genes to DEFA6 Antibody (NBP1-84281). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DEFA6 Antibody (NBP1-84281)

Discover more about diseases related to DEFA6 Antibody (NBP1-84281).
 

Pathways for DEFA6 Antibody (NBP1-84281)

View related products by pathway.

Blogs on DEFA6

There are no specific blogs for DEFA6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DEFA6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DEFA6