DEFA6 Antibody - BSA Free Summary
Description |
Novus Biologicals Rabbit DEFA6 Antibody - BSA Free (NBP1-84281) is a polyclonal antibody validated for use in IHC, WB and Simple Western. Anti-DEFA6 Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: PLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFC |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
DEFA6 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:5000 - 1:10000
- Immunohistochemistry-Paraffin 1:5000 - 1:10000
- Simple Western 4 ug/mL
- Western Blot 0.04 - 0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. See Simple Western Antibody Database for Simple Western validation: Tested in Ileum stem cells day 9 differentiated and day 12 differentiated, separated by Size, antibody dilution of 4 ug/mL, apparent MW was 15 kDa |
Control Peptide |
|
Publications |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for DEFA6 Antibody - BSA Free
Background
Defensins are a family of microbicidal and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 6, is highly expressed in the secretory granules of Paneth cells of the small intestine, and likely plays a role in host defense of human bowel. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Bv, Ca, Ch, Hu, Mu, Pm
Applications: ICC/IF, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: BA, PAGE
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Al, Bv, Ca, Hu, Mu, Pm, Rt
Applications: EM, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB, Simple Western, IHC
Publications for DEFA6 Antibody (NBP1-84281)(4)
Showing Publications 1 -
4 of 4.
Publications using NBP1-84281 |
Applications |
Species |
A Lebeau, D Bruyere, P Roncarati, P Peixoto, E Hervouet, G Cobraivill, B Taminiau, M Masson, C Gallego, G Mazzucchel, N Smargiasso, M Fleron, D Baiwir, E Hendrick, C Pilard, T Lerho, C Reynders, M Ancion, R Greimers, JC Twizere, G Daube, G Schlecht-L, F Bachelerie, JD Combes, P Melin, M Fillet, P Delvenne, P Hubert, M Herfs HPV infection alters vaginal microbiome through down-regulating host mucosal innate peptides used by Lactobacilli as amino acid sources Nature Communications, 2022-02-28;13(1):1076. 2022-02-28 [PMID: 35228537] |
|
|
Lucero CM, Fallert Junecko B, Klamar CR et al. Macaque Paneth Cells Express Lymphoid Chemokine CXCL13 and Other Antimicrobial Peptides Not Previously Described as Expressed in Intestinal Crypts. Clin Vaccine Immunol 2013-08-01 [PMID: 23803902] |
|
|
van Beelen Granlund A, Ostvik AE, Brenna O et al. REG gene expression in inflamed and healthy colon mucosa explored by in situ hybridisation. Cell Tissue Res 2013-06-01 [PMID: 23519454] |
|
|
Granlund Av, Beisvag V, Torp SH et al. Activation of REG family proteins in colitis. Scand J Gastroenterol 2011-11-01 [PMID: 21992413] |
|
|
Reviews for DEFA6 Antibody (NBP1-84281) (0)
There are no reviews for DEFA6 Antibody (NBP1-84281).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DEFA6 Antibody (NBP1-84281) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DEFA6 Products
Blogs on DEFA6