Dectin-1/CLEC7A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Dectin-1/CLEC7A Antibody [NBP2-13845] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: Dectin-1/CLEC7A Antibody [NBP2-13845] - Staining of human pancreas shows strong cytoplasmic and extracellular positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Dectin-1/CLEC7A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCP PNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLEC7A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Dectin-1/CLEC7A Protein (NBP2-13845PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Dectin-1/CLEC7A Antibody

  • Beta-glucan receptor
  • BGR
  • CD369
  • CLEC7A
  • CLECSF12
  • CLECSF12DC-associated C-type lectin 1
  • C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 12
  • C-type lectin domain family 7 member A
  • C-type lectin domain family 7, member A
  • C-type lectin superfamily member 12
  • Dectin1
  • Dectin-1
  • DECTIN1CANDF4
  • Dendritic cell-associated C-type lectin 1
  • dendritic cell-associated C-type lectin-1
  • hDectin-1
  • lectin-like receptor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
AF5248
Species: Hu
Applications: WB
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-01198
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Dectin-1/CLEC7A Antibody (NBP2-13845) (0)

There are no publications for Dectin-1/CLEC7A Antibody (NBP2-13845).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dectin-1/CLEC7A Antibody (NBP2-13845) (0)

There are no reviews for Dectin-1/CLEC7A Antibody (NBP2-13845). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Dectin-1/CLEC7A Antibody (NBP2-13845) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dectin-1/CLEC7A Products

Bioinformatics Tool for Dectin-1/CLEC7A Antibody (NBP2-13845)

Discover related pathways, diseases and genes to Dectin-1/CLEC7A Antibody (NBP2-13845). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dectin-1/CLEC7A Antibody (NBP2-13845)

Discover more about diseases related to Dectin-1/CLEC7A Antibody (NBP2-13845).
 

Pathways for Dectin-1/CLEC7A Antibody (NBP2-13845)

View related products by pathway.

Research Areas for Dectin-1/CLEC7A Antibody (NBP2-13845)

Find related products by research area.

Blogs on Dectin-1/CLEC7A

There are no specific blogs for Dectin-1/CLEC7A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dectin-1/CLEC7A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLEC7A
Entrez