Dectin-1/CLEC7A Antibody

Western Blot: Dectin-1/CLEC7A Antibody [NBP2-13845] - Analysis in control (vector only transfected HEK293T lysate) and CLEC7A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: Dectin-1/CLEC7A Antibody [NBP2-13845] - Staining of human cell line A-431 shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.

Product Discontinued

Dectin-1/CLEC7A Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCP PNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLEC7A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Dectin-1/CLEC7A Antibody

• Beta-glucan receptor
• BGR
• CD369
• CLEC7A
• CLECSF12
• CLECSF12DC-associated C-type lectin 1
• C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 12
• C-type lectin domain family 7 member A
• C-type lectin domain family 7, member A
• C-type lectin superfamily member 12
• Dectin1
• Dectin-1
• DECTIN1CANDF4
• Dendritic cell-associated C-type lectin 1
• dendritic cell-associated C-type lectin-1
• hDectin-1
• lectin-like receptor 1

Background

Dectin1 encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. The encoded glycoprotein is a small type II membrane receptor with an extracellular C-type lectin-like domain fold and a cytoplasmic domain with an immunoreceptor tyrosine-based activation motif. It functions as a pattern-recognition receptor that recognizes a variety of beta-1,3-linked and beta-1,6-linked glucans from fungi and plants, and in this way plays a role in innate immune response. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Dectin-1/CLEC7A Antibody (NBP2-13845)(1)

Publication using NBP2-13845

• van Dijk R A, Rijs K et al. Systematic Evaluation of the Cellular Innate Immune Response During the Process of Human Atherosclerosis. J Am Heart Assoc 2016-06-16 [PMID: 27312803] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: CLEC7A