Decorin Antibody

Images

 
Western Blot: Decorin Antibody [NBP1-84970] - Analysis in human cell line U-2197.
Immunohistochemistry-Paraffin: Decorin Antibody [NBP1-84970] - Staining of human ovary shows extracellular positivity.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Decorin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DCN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Decorin Protein (NBP1-84970PEP)
Publications
Read Publications using
NBP1-84970 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24634138).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Decorin Antibody

  • Bone proteoglycan II
  • CSCD
  • DCN
  • decorin proteoglycan
  • Decorin
  • dermatan sulphate proteoglycans II
  • DSPG2
  • PG40
  • PGII
  • PG-II
  • PGS2
  • PG-S2
  • proteoglycan core protein
  • SLRR1B
  • SLRR1BPGS2
  • small leucine-rich protein 1B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2667
Species: Hu
Applications: WB, IHC
NBP1-85432
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF5945
Species: Hu, Mu, Rt
Applications: WB
AF2846
Species: Hu
Applications: WB, IHC
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Decorin Antibody (NBP1-84970)(5)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(2)
All Species
Showing Publications 1 - 5 of 5.
Publications using NBP1-84970 Applications Species
Herchenhan A, Uhlenbrock F, Eliasson P et al. Lysyl Oxidase activity is required for ordered collagen fibrillogenesis by tendon cells. J. Biol. Chem. 2015 May 15 [PMID: 25979340] (WB, Human)

Details:
Decorin antibody was used at 1:500 dilution with ON 4C incubation for WB detection of established collagen fibrillogenesis regulator decorin protein on samples from the control or beta-aminoproprionitrile /BAPN treated tendon constructs which were prepared using tendon fibroblasts isolated from human semitendinosus and gracilis tendon of human anterior cruciate ligament/ACL rupture patients undergoing reconstructive surgery. See the full text for protocol related details and the data is shown in FIGURE 7A.
WB Human
Bozoky B, Savchenko A, Guven H et al. Decreased decorin expression in the tumor microenvironment. Cancer Med 2014 Jun [PMID: 24634138] (Human) Human
Henke A, Grace OC, Ashley GR et al. Stromal expression of decorin, Semaphorin6D, SPARC, Sprouty1 and Tsukushi in developing prostate and decreased levels of decorin in prostate cancer. PLoS One 2012 [PMID: 22880013]
Edlund K, Lindskog C, Saito A et al. CD99 is a novel prognostic stromal marker in non-small cell lung cancer. Int J Cancer 2012 Nov [PMID: 22392539]
Cawthorn TR, Moreno JC, Dharsee M et al. Proteomic analyses reveal high expression of decorin and endoplasmin (HSP90B1) are associated with breast cancer metastasis and decreased survival. PLoS One 2012 [PMID: 22363530]

Reviews for Decorin Antibody (NBP1-84970) (0)

There are no reviews for Decorin Antibody (NBP1-84970). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Decorin Antibody (NBP1-84970) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Decorin Products

Bioinformatics Tool for Decorin Antibody (NBP1-84970)

Discover related pathways, diseases and genes to Decorin Antibody (NBP1-84970). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Decorin Antibody (NBP1-84970)

Discover more about diseases related to Decorin Antibody (NBP1-84970).
 

Pathways for Decorin Antibody (NBP1-84970)

View related products by pathway.

PTMs for Decorin Antibody (NBP1-84970)

Learn more about PTMs related to Decorin Antibody (NBP1-84970).
 

Research Areas for Decorin Antibody (NBP1-84970)

Find related products by research area.

Blogs on Decorin

There are no specific blogs for Decorin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Decorin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DCN
Entrez