DEC2/SHARP1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PFCLPFCFLSPSAAAAYVQPFLDKSGLEKYLYPAAAAAPFPLLY |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
BHLHE41 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for DEC2/SHARP1 Antibody - BSA Free
Background
Human DEC1 is a 412 amino acid, basic helix-loop-helix (bHLH) containing protein that is involved in the control of proliferation and/or differentiation of several cell types including nerve cells, fibroblasts and chondrocytes. The bHLH region of DEC1 is structurally similar to the bHLH regions of the mammalian HES family, Drosophila hairy, and Enhancer of split m7. DEC1 is a novel direct target for cAMP in a wide range of cells, and is involved in the control of gene expression in cAMP-activated cells. DEC2, also known as SHARP1, is highly expressed in skeletal muscle and brain. The gene encoding human DEC2 maps to chromosome 12p11.23-p12.1. DEC1 and DEC2 play a role in regulating the mammalian molecular clock by suppressing the transcription of specific clock genes. Both DEC1 and DEC2 are detected in the suprachiasmimc nucleus in a circadian fashion. Brief light impulses induce the expression of DEC1 in a phase-dependent manner.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: DB, ELISA, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Eq, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
Species: Bv, Ma, Hu, Mu, Pm, Rt, Sh
Applications: ChIP, CHIP-SEQ, GS, IB, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: ICC/IF
Publications for DEC2/SHARP1 Antibody (NBP2-58737) (0)
There are no publications for DEC2/SHARP1 Antibody (NBP2-58737).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DEC2/SHARP1 Antibody (NBP2-58737) (0)
There are no reviews for DEC2/SHARP1 Antibody (NBP2-58737).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DEC2/SHARP1 Antibody (NBP2-58737) (0)