Novus Biologicals products are now on bio-techne.com

DDX1 Recombinant Protein Antigen

Images

 
There are currently no images for DDX1 Protein (NBP1-85293PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DDX1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DDX1.

Source: E. coli

Amino Acid Sequence: LGKSHIRTDDVHAKDNTRPGANSPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DDX1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85293.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DDX1 Recombinant Protein Antigen

  • ATP-dependent RNA helicase DDX1
  • DBP-RB
  • DBP-RBDEAD box polypeptide 1
  • DDX1
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 1
  • DEAD box protein 1
  • DEAD box protein retinoblastoma
  • DEAD Box-1
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 1
  • DEAD/H-Box Helicase 1
  • EC 3.6.1
  • EC 3.6.1.10
  • EC 3.6.4.13
  • UKVH5d

Background

DDX1, also known as ATP-dependent RNA helicase DDX1, is an 82.4 kDa 740 amino acid protein and is involved in unwinding RNA helixes and in altering RNA secondary structure. Current research is being conducted for diseases and disorders such as carcinoma, malaria, hepatitis, neuroblastoma, heavy chain disease, prostate cancer, and breast cancer. The protein is involved in mRNA processing pathways with other proteins such as HNRNPK, NBN, SRRM2, RELB, and ATM.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-109
Species: Hu, Mu
Applications: ChIP, ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
NBP2-93277
Species: Hu, Rt
Applications: ICC/IF, WB
NB100-81029
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-31555
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-52457
Species: Ha, Hu, Pm, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC, ICC/IF, IF, IHC, IHC-P, WB
NBP2-32887
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF755
Species: Mu
Applications: Block, WB
AF2780
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
NBP1-80992
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31661
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-40354
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
AF4530
Species: Hu
Applications: ICC, IHC, WB
H00051428-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-89945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-82493
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-20329
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB200-191
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB110-40579
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-85293PEP
Species: Hu
Applications: AC

Publications for DDX1 Protein (NBP1-85293PEP) (0)

There are no publications for DDX1 Protein (NBP1-85293PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX1 Protein (NBP1-85293PEP) (0)

There are no reviews for DDX1 Protein (NBP1-85293PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DDX1 Protein (NBP1-85293PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DDX1 Products

Research Areas for DDX1 Protein (NBP1-85293PEP)

Find related products by research area.

Blogs on DDX1

There are no specific blogs for DDX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DDX6 Antibody
NB200-191

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DDX1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX1