DDO Antibody


Immunocytochemistry/ Immunofluorescence: DDO Antibody [NBP2-32684] - Staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684] - Staining in human kidney and stomach tissues using anti-DDO antibody. Corresponding DDO RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: DDO Antibody [NBP2-32684] - Staining of human stomach shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

DDO Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: MLIPHTYPDTPIHTQKQWFRETFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADVVLGFRKMTE
Specificity of human DDO antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DDO Protein (NBP2-32684PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (81%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DDO Antibody

  • aspartic oxidase
  • D-aspartate oxidase
  • DDO-1
  • DDO-2
  • EC
  • FLJ45203


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, ICC
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for DDO Antibody (NBP2-32684) (0)

There are no publications for DDO Antibody (NBP2-32684).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDO Antibody (NBP2-32684) (0)

There are no reviews for DDO Antibody (NBP2-32684). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DDO Antibody (NBP2-32684) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DDO Products

Bioinformatics Tool for DDO Antibody (NBP2-32684)

Discover related pathways, diseases and genes to DDO Antibody (NBP2-32684). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDO Antibody (NBP2-32684)

Discover more about diseases related to DDO Antibody (NBP2-32684).

Pathways for DDO Antibody (NBP2-32684)

View related products by pathway.

PTMs for DDO Antibody (NBP2-32684)

Learn more about PTMs related to DDO Antibody (NBP2-32684).

Blogs on DDO

There are no specific blogs for DDO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DDO Antibody and receive a gift card or discount.


Gene Symbol DDO