DDB1 Recombinant Protein Antigen

Images

 
There are currently no images for DDB1 Recombinant Protein Antigen (NBP2-38538PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DDB1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DDB1.

Source: E. coli

Amino Acid Sequence: LEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DDB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38538.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DDB1 Recombinant Protein Antigen

  • damage-specific DNA binding protein 1 (127kD)
  • damage-specific DNA binding protein 1, 127kDa
  • Damage-specific DNA-binding protein 1
  • DDB p127 Subunit
  • DDB1
  • DDBA
  • DNA damage-binding protein 1
  • DNA damage-binding protein a
  • HBV X-associated protein 1
  • UV-damaged DNA-binding factor
  • UV-damaged DNA-binding protein 1
  • UV-DDB 1
  • UV-DDB1
  • XAP1
  • XAP-1
  • Xeroderma pigmentosum group E-complementing protein
  • XPCE
  • XPE
  • XPE-BF
  • XPE-binding factor

Background

Damage specific DNA binding protein (DDB) functions in nucleotide-excision repair. Its defective activity causes the repair defect in the patients with xeroderma pigmentosum complementation group E (XPE). To test whether the DNA-repair defect in the subset of XPE patients that lack DNA damage-binding activity is caused by a defect in DDB, purified human DDB protein was injected into XPE cells. The injected DDB protein stimulated DNA repair to normal levels in those strains that lacked the DDB activity but did not stimulate repair in cells from XPE patients that contained the activity. These results provided direct evidence that defective DDB activity causes the repair defect in a subset of XPE patients and establishes a role for this activity in nucleotide excision repair in vivo. It remains for mutation analysis to demonstrate whether the defect in XPE patients is in the DDB1 gene or the DDB2 gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78040
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, WB
AF3297
Species: Hu
Applications: WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-27203
Species: Ch, ChHa, Eq, Fe, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt
Applications: Flow, WB
NB100-74457
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NB100-477
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-40840
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NB100-2567
Species: Hu
Applications: IHC, IHC-P, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP3-21835
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IP, WB
AF3416
Species: Hu
Applications: WB
NBP2-16991
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-38538PEP
Species: Hu
Applications: AC

Publications for DDB1 Recombinant Protein Antigen (NBP2-38538PEP) (0)

There are no publications for DDB1 Recombinant Protein Antigen (NBP2-38538PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDB1 Recombinant Protein Antigen (NBP2-38538PEP) (0)

There are no reviews for DDB1 Recombinant Protein Antigen (NBP2-38538PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DDB1 Recombinant Protein Antigen (NBP2-38538PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DDB1 Products

Research Areas for DDB1 Recombinant Protein Antigen (NBP2-38538PEP)

Find related products by research area.

Blogs on DDB1

There are no specific blogs for DDB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DDB1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DDB1