Dcp1a Antibody (7Q8Q6)

Western Blot: Dcp1a Antibody (7Q8Q6) [NBP3-16644] - Western blot analysis of extracts of various cell lines, using Dcp1a Rabbit mAb (NBP3-16644) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Immunocytochemistry/Immunofluorescence: Dcp1a Antibody (7Q8Q6) [NBP3-16644] - Immunofluorescence analysis of U-2 OS cells using Dcp1a Rabbit mAb (NBP3-16644) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: Dcp1a Antibody (7Q8Q6) [NBP3-16644] - Immunohistochemistry of paraffin-embedded human esophageal cancer using Dcp1a Rabbit mAb (NBP3-16644) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunocytochemistry/Immunofluorescence: Dcp1a Antibody (7Q8Q6) [NBP3-16644] - Immunofluorescence analysis of NIH-3T3 cells using Dcp1a Rabbit mAb (NBP3-16644) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Dcp1a Antibody (7Q8Q6) [NBP3-16644] - Confocal imaging of NIH/3T3 cells using Dcp1a Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: Dcp1a Antibody (7Q8Q6) [Dcp1a] - Confocal imaging of NIH/3T3 cells using Dcp1a Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clone: 7Q8Q6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Dcp1a Antibody (7Q8Q6) Summary

• Description: Novus Biologicals Rabbit Dcp1a Antibody (7Q8Q6) (NBP3-16644) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 483-582 of human DCP1A (Q9NPI6). PVAGAPLVTATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSSFLSTLHEVYLQVLTKNKDNHNL
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: DCP1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Dcp1a Antibody (7Q8Q6)

• DCP1 decapping enzyme homolog A (S. cerevisiae)
• decapping enzyme hDcp1a
• EC 3.-
• FLJ21691
• mRNA-decapping enzyme 1A
• Nbla00360
• putative protein product of Nbla00360
• Smad4-interacting transcriptional co-activator
• SMAD4IP1
• SMIFHSA275986
• Transcription factor SMIF

Background

Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DCP1A