DCBLD2/ESDN Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DCBLD2/ESDN Antibody [NBP1-85582] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: DCBLD2/ESDN Antibody [NBP1-85582] - Staining of human heart muscle shows moderate cytoplasmic positivity.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DCBLD2/ESDN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AWHWRNRKKKTEGTYDLPYWDRAGWWKGMKQFLPAKAVDHEETPVRYSSSEVNHLSPREVTTVLQADSAEYAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTTSVGQPST
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DCBLD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DCBLD2/ESDN Protein (NBP1-85582PEP)
Publications
Read Publication using
NBP1-85582 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%). Human reactivity reported in scientific literature (PMID: 24918822).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DCBLD2/ESDN Antibody

  • CLCP1
  • CLCP11700055P21Rik
  • CUB, LCCL and coagulation factor V/VIII-homology domains protein 1
  • DCBLD2
  • discoidin, CUB and LCCL domain containing 2
  • discoidin, CUB and LCCL domain-containing protein 2
  • Endothelial and smooth muscle cell-derived neuropilin-like protein
  • ESDN
  • ESDNcoagulation factor V/VIII-homology domains protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88114
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77022
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
AF385
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA

Publications for DCBLD2/ESDN Antibody (NBP1-85582)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for DCBLD2/ESDN Antibody (NBP1-85582) (0)

There are no reviews for DCBLD2/ESDN Antibody (NBP1-85582). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DCBLD2/ESDN Antibody (NBP1-85582) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DCBLD2/ESDN Products

Bioinformatics Tool for DCBLD2/ESDN Antibody (NBP1-85582)

Discover related pathways, diseases and genes to DCBLD2/ESDN Antibody (NBP1-85582). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DCBLD2/ESDN Antibody (NBP1-85582)

Discover more about diseases related to DCBLD2/ESDN Antibody (NBP1-85582).
 

Pathways for DCBLD2/ESDN Antibody (NBP1-85582)

View related products by pathway.

PTMs for DCBLD2/ESDN Antibody (NBP1-85582)

Learn more about PTMs related to DCBLD2/ESDN Antibody (NBP1-85582).
 

Research Areas for DCBLD2/ESDN Antibody (NBP1-85582)

Find related products by research area.

Blogs on DCBLD2/ESDN

There are no specific blogs for DCBLD2/ESDN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DCBLD2/ESDN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DCBLD2
Entrez