DCBLD2/ESDN Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DCBLD2/ESDN Antibody [NBP1-85582] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: DCBLD2/ESDN Antibody [NBP1-85582] - Staining of human heart muscle shows moderate cytoplasmic positivity.

• Reactivity: Hu, Mu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DCBLD2/ESDN Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AWHWRNRKKKTEGTYDLPYWDRAGWWKGMKQFLPAKAVDHEETPVRYSSSEVNHLSPREVTTVLQADSAEYAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTTSVGQPST
• Predicted Species: Mouse (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DCBLD2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: IHC reported in scientific literature (PMID: 24918822). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DCBLD2/ESDN Protein (NBP1-85582PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%). Human reactivity reported in scientific literature (PMID: 24918822).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DCBLD2/ESDN Antibody - BSA Free

• CLCP1
• CLCP11700055P21Rik
• CUB, LCCL and coagulation factor V/VIII-homology domains protein 1
• DCBLD2
• discoidin, CUB and LCCL domain containing 2
• discoidin, CUB and LCCL domain-containing protein 2
• Endothelial and smooth muscle cell-derived neuropilin-like protein
• ESDN
• ESDNcoagulation factor V/VIII-homology domains protein 1

Background

DCBLD2, otherwise known as ESDN (endothelial and smooth muscle cell-derived neuropilin-like molecule) is a novel type-I transmembrane protein with the longest cleavable secretory signal sequence among eukaryotes. It is expressed in various tissues; particularly highly expressed in cultured vascular smooth muscle cells. DCBLD2 is considered to play a role in regulation of vascular cell growth and may have a wide variety of functions in other tissues including the nervous system, like neuropilins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DCBLD2/ESDN Antibody (NBP1-85582)(2)

Publications using NBP1-85582

• Chiara Francavilla, Michela Lupia, Kalliopi Tsafou, Alessandra Villa, Katarzyna Kowalczyk, Rosa Rakownikow Jersie-Christensen, Giovanni Bertalot, Stefano Confalonieri, Søren Brunak, Lars J. Jensen, Ugo Cavallaro, Jesper V. Olsen Phosphoproteomics of Primary Cells Reveals Druggable Kinase Signatures in Ovarian Cancer Cell Reports 2017-03-28 [PMID: 28355574]
• Fukumoto I, Kinoshita T, Hanazawa T et al. Identification of tumour suppressive microRNA-451a in hypopharyngeal squamous cell carcinoma based on microRNA expression signature. Br J Cancer 2014-07-15 [PMID: 24918822] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: DCBLD2