DC8 Antibody


Immunocytochemistry/ Immunofluorescence: DC8 Antibody [NBP2-13678] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli, plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: DC8 Antibody [NBP2-13678] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: DC8 Antibody [NBP2-13678] - Staining of human tonsil shows moderate nuclear positivity in germinal center cells and strong nuclear staining in non-germinal center cells.
Immunohistochemistry-Paraffin: DC8 Antibody [NBP2-13678] - Staining of human lymph node shows high expression.
Immunohistochemistry-Paraffin: DC8 Antibody [NBP2-13678] - Staining in human lymph node and pancreas tissues using anti-NSL1 antibody. Corresponding NSL1 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

DC8 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FVQKLGDALPEEIREPALRDAQWTFESAVQENISINGQAWQEASDNCFMD SDIKVLEDQFDEIIVDIATKRKQYP
Specificity of human DC8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
DC8 Protein (NBP2-13678PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DC8 Antibody

  • C1orf48
  • chromosome 1 open reading frame 48
  • DC8
  • DKFZp566O1646
  • kinetochore-associated protein NSL1 homolog
  • MIS14
  • NSL1, MIND kinetochore complex component, homolog (S. cerevisiae)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ha, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IP, PLA
Species: Hu
Applications: WB, ELISA, IP
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IP
Species: Hu, Mu, Fi
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ICC, IF
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
Species: Hu
Applications: ELISA, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for DC8 Antibody (NBP2-13678) (0)

There are no publications for DC8 Antibody (NBP2-13678).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DC8 Antibody (NBP2-13678) (0)

There are no reviews for DC8 Antibody (NBP2-13678). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DC8 Antibody (NBP2-13678) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DC8 Products

Bioinformatics Tool for DC8 Antibody (NBP2-13678)

Discover related pathways, diseases and genes to DC8 Antibody (NBP2-13678). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DC8 Antibody (NBP2-13678)

Discover more about diseases related to DC8 Antibody (NBP2-13678).

Pathways for DC8 Antibody (NBP2-13678)

View related products by pathway.

Research Areas for DC8 Antibody (NBP2-13678)

Find related products by research area.

Blogs on DC8

There are no specific blogs for DC8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DC8 Antibody and receive a gift card or discount.


Gene Symbol NSL1