DC8 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DC8 Antibody [NBP2-13678] Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli, plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: DC8 Antibody [NBP2-13678] - Staining of human tonsil shows moderate nuclear positivity in germinal center cells and strong nuclear staining in non-germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DC8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FVQKLGDALPEEIREPALRDAQWTFESAVQENISINGQAWQEASDNCFMD SDIKVLEDQFDEIIVDIATKRKQYP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NSL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
DC8 Protein (NBP2-13678PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DC8 Antibody

  • C1orf48
  • chromosome 1 open reading frame 48
  • DC8
  • DKFZp566O1646
  • kinetochore-associated protein NSL1 homolog
  • MIS14
  • NSL1, MIND kinetochore complex component, homolog (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2359
Species: Hu
Applications: WB, IHC, IP
NB100-2586
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-88302
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-338
Species: Hu, Mu, Rt, Po, Ha, Mk
Applications: WB, Flow, ICC/IF, IHC, IP
NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-28879
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00151648-M01
Species: Hu
Applications: WB, ELISA, IP
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-41201
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IP
NB120-3535
Species: Hu, Mu, Fi
Applications: WB, ICC/IF, IHC
NB100-2364
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-40623
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
NBP2-27562
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF6144
Species: Hu
Applications: WB, Simple Western
NBP1-81615
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
H00000699-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
NBP1-82546
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13678
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for DC8 Antibody (NBP2-13678) (0)

There are no publications for DC8 Antibody (NBP2-13678).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DC8 Antibody (NBP2-13678) (0)

There are no reviews for DC8 Antibody (NBP2-13678). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DC8 Antibody (NBP2-13678) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DC8 Products

Bioinformatics Tool for DC8 Antibody (NBP2-13678)

Discover related pathways, diseases and genes to DC8 Antibody (NBP2-13678). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DC8 Antibody (NBP2-13678)

Discover more about diseases related to DC8 Antibody (NBP2-13678).
 

Pathways for DC8 Antibody (NBP2-13678)

View related products by pathway.

Research Areas for DC8 Antibody (NBP2-13678)

Find related products by research area.

Blogs on DC8

There are no specific blogs for DC8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DC8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NSL1