DC8 Antibody - BSA Free

Immunohistochemistry-Paraffin: DC8 Antibody [NBP2-13678] - Staining in human lymph node and pancreas tissues using anti-NSL1 antibody. Corresponding NSL1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: DC8 Antibody [NBP2-13678] - Staining of human tonsil shows moderate nuclear positivity in germinal center cells and strong nuclear staining in non-germinal center cells.

Immunohistochemistry-Paraffin: DC8 Antibody [NBP2-13678] - Staining of human lymph node shows high expression.

Immunohistochemistry-Paraffin: DC8 Antibody [NBP2-13678] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DC8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DC8 Antibody - BSA Free (NBP2-13678) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: FVQKLGDALPEEIREPALRDAQWTFESAVQENISINGQAWQEASDNCFMDSDIKVLEDQFDEIIVDIATKRKQYP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NSL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  DC8 Protein (NBP2-13678PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DC8 Antibody - BSA Free

• C1orf48
• chromosome 1 open reading frame 48
• DC8
• DKFZp566O1646
• kinetochore-associated protein NSL1 homolog
• MIS14
• NSL1, MIND kinetochore complex component, homolog (S. cerevisiae)

Background

DC8 encodes a protein with two coiled-coil domains that localizes to kinetochores, which are chromosome-associated structures that attach to microtubules and mediate chromosome movements during cell division. It is part of a conserved protein complex that includes two chromodomain-containing proteins and a component of the outer plate of the kinetochore. This protein complex is proposed to bridge centromeric heterochromatin with the outer kinetochore structure. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NSL1