DBF4B Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit DBF4B Antibody - BSA Free (NBP2-87248) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human DBF4B. Peptide sequence: SKEVSYIVSSRREVKAESSGKSHRGCPSPSPSEVRVETSAMVDPKGSHPR The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DBF4B |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for DBF4B Antibody - BSA Free
Background
DBF4B, also known as Protein DBF4 homolog B, consists of four isoforms of sizes 67.2 kDa, 47.2 kDa, 54.7 kDa, and 18.4 kDa and is involved in DNA replication and cellular generation by stimulating kinase activity. The protein has not been researched in association with any diseases. The protein interacts with PTEN, APC, CDC7, MDFI, and KRTAP4-12 proteins during the early S phase of cell cycle DNA replication.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IP, KD, WB
Species: Hu
Applications: WB
Publications for DBF4B Antibody (NBP2-87248) (0)
There are no publications for DBF4B Antibody (NBP2-87248).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DBF4B Antibody (NBP2-87248) (0)
There are no reviews for DBF4B Antibody (NBP2-87248).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DBF4B Antibody (NBP2-87248) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DBF4B Products
Blogs on DBF4B