DBF4B Antibody - Azide and BSA Free Summary
| Immunogen |
DRF1 (NP_079380.1, 1 a.a. - 170 a.a.) full-length human protein. MSEPGKGDDCLELESSMAESRLRAPDLGVSRCLGKCQKNSPGARKHPFSGKSFYLDLPAGKNLQFLTGAIQQLGGVIEGFLSKEVSYIVSSRREVKAESSGKSHRGCPSPSPSEVRVETSAMVDPKGSHPRPSRKPVDSVPLSRGKELLQKAIRNQVSWGKMGQSRWSPA |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
DBF4B |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This antibody is useful for Western Blot |
Reactivity Notes
This product is reactive against Human.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for DBF4B Antibody - Azide and BSA Free
Background
This gene encodes a regulator of the CDC7-like 1 protein, a serine-threonine kinase which links cell cycle regulation to genome duplication. This protein localizes to the nucleus and its expression is cell cycle-regulated. Alternative splicing of this gene results in two transcript variants encoding different isoforms. Additional transcript variants have been described, but their full length sequences have not been determined.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IP, KD, WB
Species: Hu
Applications: WB
Publications for DBF4B Antibody (H00080174-B01P) (0)
There are no publications for DBF4B Antibody (H00080174-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DBF4B Antibody (H00080174-B01P) (0)
There are no reviews for DBF4B Antibody (H00080174-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DBF4B Antibody (H00080174-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DBF4B Products
Blogs on DBF4B