DBF4B Antibody (1A7)

Images

 
Sandwich ELISA: DBF4B Antibody (1A7) [H00080174-M01] - Detection limit for recombinant GST tagged DBF4B is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1A7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DBF4B Antibody (1A7) Summary

Immunogen
DBF4B (NP_663696, 201 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VKKQQPKKPEGTCPAAESRTRKVARLKAPFLKIEDESRKFRPFHHQFKSFPEISFLGPKDASPFEAPTTLGSMHHTRESKDGEPSPRSAAHTMPRRKKG
Specificity
DBF4B - DBF4 homolog B (S. cerevisiae) (1A7)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DBF4B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publication using H00080174-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DBF4B Antibody (1A7)

  • Activator of S phase kinase-like protein 1
  • activator of S-phase kinase-like protein 1
  • ASKL1CHIFB
  • ASK-like protein 1
  • chifb
  • Chiffon homolog B
  • DBF4 homolog B (S. cerevisiae)
  • Dbf4-related factor 1
  • DRF1MGC15009
  • FLJ13087
  • protein DBF4 homolog B
  • ZDBF1B
  • zinc finger, DBF-type containing 1B

Background

This gene encodes a regulator of the CDC7-like 1 protein, a serine-threonine kinase which links cell cycle regulation to genome duplication. This protein localizes to the nucleus and its expression is cell cycle-regulated. Alternative splicing of this gene results in two transcript variants encoding different isoforms. Additional transcript variants have been described, but their full length sequences have not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-231
Species: Hu
Applications: WB, IHC, IHC-P, KD
NB120-10535
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, MiAr
H00010926-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-247
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-288
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
H00004176-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA, S-ELISA
NB100-1768
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-03414
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-308
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP, In vitro, KO
AF1444
Species: Mu
Applications: WB, IHC
MAB2878
Species: Hu
Applications: Flow, CyTOF-ready
NB100-91273
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56546
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-36768
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00080174-M01
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for DBF4B Antibody (H00080174-M01)(1)


Showing Publication 1 - 1 of 1.
Publication using H00080174-M01 Applications Species
Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018

Reviews for DBF4B Antibody (H00080174-M01) (0)

There are no reviews for DBF4B Antibody (H00080174-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DBF4B Antibody (H00080174-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DBF4B Products

Bioinformatics Tool for DBF4B Antibody (H00080174-M01)

Discover related pathways, diseases and genes to DBF4B Antibody (H00080174-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on DBF4B

There are no specific blogs for DBF4B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DBF4B Antibody (1A7) and receive a gift card or discount.

Bioinformatics

Gene Symbol DBF4B
Entrez
Uniprot