DBC1/p30 Antibody

Staining of human cerebral cortex, kidney, liver and testis using NBP1-85305 (A) shows similar protein distribution across tissues to independent antibody NBP1-85304 (B).

Analysis using NBP1-85305 (A) shows similar pattern to independent antibody NBP1-85304 (B).

Analysis in human testis and liver tissues. Corresponding CCAR2 RNA-seq data are presented for the same tissues.

Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Staining of human kidney shows strong nuclear positivity in cells in tubules.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Staining of human liver shows very weak nuclear positivity in hepatocytes.

Staining of human cell line U-2 OS shows localization to nucleoplasm.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

DBC1/p30 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MLLSLPEKVVSPPEPEKEEAAKEEATKEEEAIKEEVVKEPKDEAQNEGPATESEAPLKEDGLLPKPLSSGGEEEEKPRGEASEDLCEMALD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCAR2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DBC1/p30 Antibody

• DBC.1
• DBC1deleted in breast cancer 1
• DBC-1p30 DBC protein
• Deleted in breast cancer gene 1 protein
• KIAA1967
• NET35
• p30 DBC
• p30DBC

Background

DBC1 inhibits SIRT1 deacetylase activity leading to increasing levels of p53/TP53 acetylation and p53-mediatedapoptosis. Inhibits SUV39H1 methyltransferase activity

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DBC1/p30 Antibody (NBP1-85305)(1)

Publication using NBP1-85305

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: CCAR2