DAZL Antibody - BSA Free

Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85306] - Analysis in human testis and endometrium tissues. Corresponding DAZL RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85306] - Staining of human cerebral cortex, endometrium, prostate and testis using Anti-DAZL antibody NBP1-85306 (A) shows similar protein distribution across tissues to independent antibody NBP1-85307 (B).

Western Blot: DAZL Antibody [NBP1-85306] - Analysis in control (vector only transfected HEK293T lysate) and DAZL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85306] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85306] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85306] - Staining of human endometrium shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85306] - Staining of human prostate shows no positivity in glandular cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DAZL Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DAZL Antibody - BSA Free (NBP1-85306) is a polyclonal antibody validated for use in IHC and WB. Anti-DAZL Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDKRVHHFRRSRAMLK
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DAZL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DAZL Protein (NBP1-85306PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DAZL Antibody - BSA Free

• DAZHSPGY-like-autosomal
• DAZL1DAZ-like autosomal
• DAZLA
• Deleted in azoospermia-like 1
• deleted in azoospermia-like
• germline specific RNA binding protein
• MGC26406
• spermatogenesis gene on the Y-like autosomal
• SPGYLADAZ homolog

Background

DAZL is a RNA-binding protein, which is essential for gametogenesis. Plays a central role during spermatogenesis. May act by binding to the 3'-UTR of mRNA and thereby regulating the translation of key transcripts

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DAZL Antibody (NBP1-85306)(1)

Publication using NBP1-85306

• Djureinovic D, Fagerberg L, Hallstrom B et al. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Mol Hum Reprod 2014-06-01 [PMID: 24598113]

Bioinformatics

• Gene Symbol: DAZL