DAZL Antibody


Western Blot: DAZL Antibody [NBP1-85306] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85306] - Staining in human testis and endometrium tissues using anti-DAZL antibody. Corresponding DAZL RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85306] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: DAZL Antibody [NBP1-85306] - Staining of human testis shows high expression.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

DAZL Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: HEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDKRVHHFRRSRAMLK
Specificity of human DAZL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DAZL Protein (NBP1-85306PEP)
Read Publication using NBP1-85306.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24598113)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DAZL Antibody

  • DAZHSPGY-like-autosomal
  • DAZL1DAZ-like autosomal
  • Deleted in azoospermia-like 1
  • deleted in azoospermia-like
  • germline specific RNA binding protein
  • MGC26406
  • spermatogenesis gene on the Y-like autosomal
  • SPGYLADAZ homolog


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IP
Species: Hu
Applications: WB, ICC/IF, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, ChIP, ICC
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
Species: Mu, Ha
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for DAZL Antibody (NBP1-85306)(1)

Reviews for DAZL Antibody (NBP1-85306) (0)

There are no reviews for DAZL Antibody (NBP1-85306). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DAZL Antibody (NBP1-85306) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DAZL Products

Bioinformatics Tool for DAZL Antibody (NBP1-85306)

Discover related pathways, diseases and genes to DAZL Antibody (NBP1-85306). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DAZL Antibody (NBP1-85306)

Discover more about diseases related to DAZL Antibody (NBP1-85306).

Pathways for DAZL Antibody (NBP1-85306)

View related products by pathway.

PTMs for DAZL Antibody (NBP1-85306)

Learn more about PTMs related to DAZL Antibody (NBP1-85306).

Blogs on DAZL

There are no specific blogs for DAZL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DAZL Antibody and receive a gift card or discount.


Gene Symbol DAZL