DAZ3 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the C region of human DAZ3. Peptide sequence: PAYPNSAVQVTTGYQFHVYNYQMPPQCPVGEQRRNLWTEAYKWWYLVCLI The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DAZ3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for DAZ3 Antibody - BSA Free
Background
DAZ3, also known as Deleted in azoospermia protein 3, consists of a 55 kDa and a 49.5 kDa isoform and is involved in regulating the translation of the 3'-UTR sequence of mRNAs. It is a candidate gene site for AZF, or human Y-chromosomal azoospermia factor. Research with DAZ3 is being conducted with disorders and diseases such as infertility, spermatogenic failure, cryptorchidism, and azoospermia. This protein has been linked to the spermatogenesis pathway where it interacts with UBC and PUM2.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ChIP-EXO-SEQ, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: Flow, IF, IHC, IHC-Fr
Species: Hu
Applications: WB
Publications for DAZ3 Antibody (NBP2-86615) (0)
There are no publications for DAZ3 Antibody (NBP2-86615).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DAZ3 Antibody (NBP2-86615) (0)
There are no reviews for DAZ3 Antibody (NBP2-86615).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DAZ3 Antibody (NBP2-86615) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DAZ3 Products
Blogs on DAZ3