Deleted in azoospermia 4 Antibody


Western Blot: Deleted in azoospermia 4 Antibody [NBP1-57481] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: Deleted in azoospermia 4 Antibody [NBP1-57481] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X more
Immunohistochemistry-Paraffin: Deleted in azoospermia 4 Antibody [NBP1-57481] - Human Stomach Tissue, Epithelial cells of funic gland (Indicated with Arrows) 4-8ug/ml.

Product Details

Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Gt, RbSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Deleted in azoospermia 4 Antibody Summary

Synthetic peptides corresponding to DAZ4 (deleted in azoospermia 4) The peptide sequence was selected from the N terminal of DAZ4. Peptide sequence MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDAR.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against DAZ4 and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Deleted in azoospermia 4 Antibody

  • deleted in azoospermia 4
  • deleted in azoospermia protein 4
  • pDP1680
  • pDP1681


This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). This RNA-binding protein is important for spermatogenesis.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Rb
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: Flow, IHC, IHC-Fr
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Gt, Rb
Applications: WB, IHC, IHC-P

Publications for Deleted in azoospermia 4 Antibody (NBP1-57481) (0)

There are no publications for Deleted in azoospermia 4 Antibody (NBP1-57481).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Deleted in azoospermia 4 Antibody (NBP1-57481) (0)

There are no reviews for Deleted in azoospermia 4 Antibody (NBP1-57481). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Deleted in azoospermia 4 Antibody (NBP1-57481) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Deleted in azoospermia 4 Products

Bioinformatics Tool for Deleted in azoospermia 4 Antibody (NBP1-57481)

Discover related pathways, diseases and genes to Deleted in azoospermia 4 Antibody (NBP1-57481). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Deleted in azoospermia 4 Antibody (NBP1-57481)

Discover more about diseases related to Deleted in azoospermia 4 Antibody (NBP1-57481).

Pathways for Deleted in azoospermia 4 Antibody (NBP1-57481)

View related products by pathway.

Blogs on Deleted in azoospermia 4

There are no specific blogs for Deleted in azoospermia 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Deleted in azoospermia 4 Antibody and receive a gift card or discount.


Gene Symbol DAZ4