BPY2 Antibody

Images

 
Western Blot: BPY2 Antibody [NBP1-98290] - Titration: 1.0 ug/ml Positive Control: HepG2 Whole Cell.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BPY2 Antibody Summary

Immunogen
The immunogen for this antibody is BPY2 - C-terminal region. Peptide sequence VRNTLLQSKVGLLTYYVKLYPGEVTLLTRPSIQMRLCCITGSVSRPRSQK. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BPY2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for BPY2 Antibody

  • testis-specific basic protein Y 2
  • basic charge, Y-linked, 2
  • BPY2A
  • VCY2
  • VCY2A

Background

This gene is located in the nonrecombining portion of the Y chromosome, and expressed specifically in testis. The encoded protein interacts with ubiquitin protein ligase E3A and may be involved in male germ cell development and male infertility. Three nearly identical copies of this gene exist on chromosome Y; two copies are part of a palindromic region. This record represents the copy outside of the palidromic region.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001617-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-32887
Species: Hu
Applications: IHC, IHC-P, WB
H00009426-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP3-16963
Species: Hu
Applications: IHC, IHC-P
NBP3-05663
Species: Hu, Mu, Rt
Applications: WB
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
H00058524-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP3-16073
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00007258-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-37463
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP1-90195
Species: Hu
Applications: IHC, IHC-P, WB
H00007337-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
NBP1-47281
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP2-20948
Species: Hu
Applications: WB
NBP1-42827
Species: Ch, Fi, Hu, Pm, Mu, Rt, Re, Xp
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP2-32630
Species: Hu
Applications: IHC, IHC-P

Publications for BPY2 Antibody (NBP1-98290) (0)

There are no publications for BPY2 Antibody (NBP1-98290).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BPY2 Antibody (NBP1-98290) (0)

There are no reviews for BPY2 Antibody (NBP1-98290). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BPY2 Antibody (NBP1-98290) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BPY2 Products

Array NBP1-98290

Bioinformatics Tool for BPY2 Antibody (NBP1-98290)

Discover related pathways, diseases and genes to BPY2 Antibody (NBP1-98290). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BPY2 Antibody (NBP1-98290)

Discover more about diseases related to BPY2 Antibody (NBP1-98290).
 

Pathways for BPY2 Antibody (NBP1-98290)

View related products by pathway.

PTMs for BPY2 Antibody (NBP1-98290)

Learn more about PTMs related to BPY2 Antibody (NBP1-98290).

Blogs on BPY2

There are no specific blogs for BPY2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BPY2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BPY2
Uniprot