Daxx Antibody - BSA Free Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: DEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSG |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
DAXX |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
Application Notes |
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, pH 7.2, containing 40% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Daxx Antibody - BSA Free
Background
Daxx (death-domain-associated protein) was originally identified as a cytoplasmic protein that binds to the death domain of the transmembrane death receptor Fas. It is now that known that the a large porportion of Daxx molecules are nuclear and associate with the promyelocytic leukaemia nuclear body (PML-NB) and other subnuclear domains (reviewed in Salomoni and Khelifi). The promyelocytic leukemia protein Pml is an essential component of the PML-NB. Data suggests that certain stimuli including Fas stimulation, causes Daxx to be translocated from the nucleus to the cytoplasm. Daxx is ubiquitously expressed, and particularly high levels of Daxx have been reported in the thymus and testes. At the cellular level Daxx may be found in cytoplasm and within heterochromatic regions of the nucleus. Daxx has been reported to interact and co-localize with Pml in the nucleus of tumor cell lines and primary cells. Pml is necessary for Fas-induced cell death and Daxx pro-apoptotic functions. Daxx is thought to have both pro- and anti-apoptotic functions depending on the stimulus and the cell type. Daxx pro-apoptotic functions appear to occur in both the cytoplasm and nucleus. Although the mechanisms remain to be fully elucidated, research indicates that Daxx plays a role in the pathology of human diseases including cancer and neurodegerative disorders. Human Daxx is a 740 amino acid protein (GenBank no. gi/62898369).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, PLA, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, Micro, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: BA
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, Neut
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ICC/IF
Publications for Daxx Antibody (NBP2-76512) (0)
There are no publications for Daxx Antibody (NBP2-76512).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Daxx Antibody (NBP2-76512) (0)
There are no reviews for Daxx Antibody (NBP2-76512).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Daxx Antibody (NBP2-76512) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Daxx Products
Research Areas for Daxx Antibody (NBP2-76512)
Find related products by research area.
|
Blogs on Daxx