Daxx Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Daxx Antibody [NBP2-56390] - Staining of human cell line SH-SY5Y shows localization to nucleus & nuclear bodies. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Daxx Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTR
Specificity
Specificity of human Daxx antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DAXX
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Daxx Recombinant Protein Antigen (NBP2-56390PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Daxx Antibody

  • BING2
  • CENP-C binding protein
  • DAP6
  • DAP6MGC126245
  • Daxx
  • death domain-associated protein 6
  • death-associated protein 6
  • death-domain associated protein
  • EAP1
  • ETS1-associated protein 1
  • Fas death domain-associated protein
  • Fas-binding protein
  • hDaxx
  • MGC126246

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-59787
Species: Hu, Mu
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, IP, PLA, KD
NB100-81788
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67514
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-86060
Species: Hu
Applications: WB, IHC, IHC-P, Micro
MAB7047
Species: Hu
Applications: WB, ICC
NBP1-83077
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-56116
Species: Hu, Mu, Rt, Ma
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-92897
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB2676
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-75477
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP2-56390
Species: Hu
Applications: ICC/IF

Publications for Daxx Antibody (NBP2-56390) (0)

There are no publications for Daxx Antibody (NBP2-56390).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Daxx Antibody (NBP2-56390) (0)

There are no reviews for Daxx Antibody (NBP2-56390). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Daxx Antibody (NBP2-56390) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Daxx Products

Bioinformatics Tool for Daxx Antibody (NBP2-56390)

Discover related pathways, diseases and genes to Daxx Antibody (NBP2-56390). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Daxx Antibody (NBP2-56390)

Discover more about diseases related to Daxx Antibody (NBP2-56390).
 

Pathways for Daxx Antibody (NBP2-56390)

View related products by pathway.

PTMs for Daxx Antibody (NBP2-56390)

Learn more about PTMs related to Daxx Antibody (NBP2-56390).
 

Research Areas for Daxx Antibody (NBP2-56390)

Find related products by research area.

Blogs on Daxx

There are no specific blogs for Daxx, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Daxx Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DAXX