DAP3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DAP3 Antibody [NBP1-88568] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.

Immunohistochemistry-Paraffin: DAP3 Antibody [NBP1-88568] - Staining of human colon shows moderate to strong positivity in mitochondria in glandular cells.

Immunohistochemistry-Paraffin: DAP3 Antibody [NBP1-88568] - Staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: DAP3 Antibody [NBP1-88568] - Staining of human prostate shows moderate to strong positivity in mitochondria in glandular cells.

Immunohistochemistry-Paraffin: DAP3 Antibody [NBP1-88568] - Staining of human duodenum shows moderate to strong positivity in mitochondria in glandular cells.

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DAP3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKAYLPQELLGKEGFDALDPFIPILVSNYNPKEF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DAP3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DAP3 Protein (NBP1-88568PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DAP3 Antibody - BSA Free

• bMRP-10
• DAP-3Death-associated protein 3
• death associated protein 3
• DKFZp686G12159,28S ribosomal protein S29, mitochondrial
• FLJ12817
• MGC126058
• MGC126059
• mitochondrial 28S ribosomal protein S29
• MRP-S29Ionizing radiation resistance conferring protein
• MRPS29S29mt

Background

Death Associated Protein 3 (DAP3) is a 46 kDa protein carrying a potential nucleotide binding motif (P-loop) at its N-terminal region. The protein is widely expressed, and the expression is upregulated during membrane-receptor mediated apoptosis. In interferon-gamma and Fas induced apoptosis, DAP3 acts as a positive mediator by functioning downstream of the receptor signaling complex and upstream of the effector caspases. However, the mechanism for its function is largely unknown. Interestingly, the N-terminal 230 amino acid fragment of DAP3 alone protects cells from Fas induced cell death. The same region of DAP3 also serves as a binding site for the glucocorticoid receptor and mediates receptor functions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DAP3